Query Sequence
>199958
MTAPIIITGVGKRIGYALAKHLLAQGHKVIGTYRSHYPSIDELQSLGATLIQCDFYDNAQVQNLIEQLSQYPKFRAIIHNASDWLADNSPEFAAHEVMQRMIQVHVNVPYQMNLALASKLQAGAEGEIGASDIIHITDYVAEKGSAKHIAYAASKAALDNLTLSFAAKLAPEVKVNAIAPAMILFNPSDDEAYRQKTLAKAILPKEAGNHEIIELMEYLLNSRYVTGRSHHVDGGRHLR
Hit FamilyFIG00138402
Hit Family FunctionFolM Alternative dihydrofolate reductase 1


back to search