Query Sequence
>1936841
MAKNYAALARSVIAALGGVDNISAVTHCMTRLRFVIKDDALIDSPTLKTIPGVLGVVRSDNQCQVIIGNTVSQAFQEVVSLLPGDMQPAQPVGKPKLTLRRIGAGILDALIGTMSPLIPAIIGGSMVKLLAMILEMSGVLTKGSPTLTILNVIGDGAFFFLPLMVAASAAIKFKTNMSLAIAIAGVLVHPSFIELMAKAAQGEHVEFALIPVTAVKYTYTVIPALVMTWCLSYIERWVDSITPAVTKNFLKPMLIVLIAAPLAILLIGPIGIWIGSAISALVYTIHGYLGWLSVAIMGALWPLLVMTGMHRVFTPTIIQTIAETGKEGMVMPSEIGANLSLGGSSLAVAWKTKNPELRQTALAAAASAIMAGISEPALYGVAIRLKRPLIASLISGFICGAVAGMAGLASHSMAAPGLFTSVQFFDPANPMSIVWVFAVMALAVVLSFILTLLLGFEDIPVEEAAAQARKYQSVQPTVAKEVSLN
Hit FamilyFIG00005470
Hit Family FunctionPTS system, arbutin-, cellobiose-, and salicin-specific IIBC component (EC 2.7.1.69)


back to search