Query Sequence
>17989
MTKIIAVTACPSGVAHTYMAAEALESAAKAKGWEVKVETQGSIGLENELTAEDVASADMVILTKDIGIKFEERFAGKTIVRVNISDAVKRADAIMSKIEAHLAQTA
Hit FamilyFIG00731605
Hit Family FunctionPTS system fructose-like IIB component 1 precursor (EC 2.7.1.69)


back to search