Query Sequence
>17206
MPNIVLSRIDERLIHGQVGVQWVGFAGANLVLVANDEVAEDPVQQNLMEMVLAEGIAVRFWTLQKVIDNIHRAADRQKILLVCKTPADFLTLVKGGVPVNRINVGNMHYANGKQQIAKTVSVDAGDIAAFNDLKTAGVECFVQGVPTEPAVDLFKLL
Hit FamilyFIG00002159
Hit Family FunctionPTS system, N-acetylgalactosamine-specific IIB component (EC 2.7.1.69)


back to search