Query Sequence
>16822
MSDFAKVEQSLREEMTRIASSFFQRGYATGSAGNLSLLLPDGNLLATPTGSCLGNLDPQRLSKVAADGEWLSGDKPSKEVLFHLALYRNNPRCKAVVHLHSTWSTALSCLQGLDSSNVIRPFTPYVVMRMGNVPLVPYYRPGDKRIAQDLAELAADNQAFLLANHGPVVCGESLQEAANNMEELEETAKLIFILGDRPIRYLTAGEIAELRS
Hit FamilyFIG00004579
Hit Family FunctionRibulose-5-phosphate 4-epimerase and related epimerases and aldolases


back to search