Query Sequence
>15362
MIQTFFDFPVYFKFFIGLFALVNPVGIIPVFISMTSYQTAAARNKTNLTANLSVAIILWISLFLGDTILQLFGISIDSFRIAGGILVVTIAMSMISGKLGEDKQNKQEKSETAVRESIGVVPLALPLMAGPGAISSTIVWGTRYHSISYLFGFFVAIALFALCCWGLFRMAPWLVRVLRQTGINVITRIMGLLLMALGIEFIVTGIKGIFPGLLN
Hit FamilyFIG00524042
Hit Family FunctionPutative membrane protein


back to search