Query Sequence
>14529
MLQSNEYFSGKVKSIGFSSSSTGRASVGVMVEGEYTFSTAEPEEMTVISGALNVLLPDATDWQVYEAGSVFNVPGHSEFHLQVAEPTSYLCRYL
Hit FamilyFIG00002791
Hit Family FunctionCytoplasmic protein YaiE


back to search