(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00013767

fig|525318.3.peg.1981   Lactobacillus buchneri ATCC 11577                           ELGHFLGVTQSMVSKLRH−−DKSPLHFDDLANLFKSTEGLLGADEFKISVLNKFSNGFIPPLPNYYYVSTNLAALSNRVITEMGQSMDALKEALDDFSDPSSPNNIKNISDPEQAFAQCYDVLYYLLPLMAIIANTYGLS                       
fig|52979.1.peg.49   Bacteriophage phig1e                                                            ALPNQN−−−−QFFAIELAHRFVG−−VTTPVIDGDRIMKEPLAMAVKTMPELSQALAAIQDSLDELTIPKEDLKPNDFDDPKKLVAECFDAVLYLLNLIAYVCRGFDLSMQDQLKQRMKKWFKDGVVKHRKE
fig|527024.3.peg.4890   Bacillus thuringiensis serovar tochigiensis BGSC 4Y1         SIGKEVAMARKRKGITQERLSSEIPVSRESLAKYET−−EKRRIPKDLRKCITEGIDD−−−−PQLFFKMWSEATGHVSIPFFNGEYIDLHPTSMRYMVQQETNEALKQLDTLC−−WFKPSQAWSEQEKESMKRAMHEILDATGSMMSLVAVLCDQYGFSMTDIFK−−−−YWKVS        
fig|526993.3.peg.5974   Bacillus cereus AH1272         SIGKEVAMARKRKGITQERLSSEIPVSRESLAKYET−−EKRRIPKDLRKCITEGIDD−−−−PQLFFKMWSEATGHVSIPFFNGEYIDLHPTSMRYMVQQETNEALKQLDTLC−−WFKPSQAWSEQEKESMKRTMHEILDATGSMMSLVAVLCDQYGFSMTDIFK−−−−YWKVS        
fig|527019.3.peg.6833   Bacillus thuringiensis IBL 200         SIGKEVAMARKRKGITQEQLSLEIPVSRESLAKYET−−EQRRLPEDLRTCITEGIDD−−−−PQLFFKMWSEATGHVSVPFFNGEHIDLHPTSMRYMVNQEINEALKQLDTVC−−WFKPSQTCTESEKEDLKKVMHEILDATGSMMSLVAVLCDQYGISMKEVFK−−−−YWKVS        
fig|527030.3.peg.3496   Bacillus thuringiensis serovar huazhongensis BGSC 4BD1         SIGKEVAMARKRKGITQEQLSLEIPVSRESLAKYET−−EQRRLPEDLRKCITEGIDD−−−−PQLFFKMWNEATGHVSVPFFNGEHIDLHPTSMRYMVNQEINEALKQLDTVC−−WFKPSKTWSESEKEDLKKVMHEILDATGSMMSLVAVLCDQYGISMKEVFK−−−−YWKVS        
fig|526967.3.peg.164   Bacillus cereus 172560W         SIGKEVAMARKRKGITQEQLSLEIPVSRESLAKYET−−EQRRLPEDLRKCITEGIDD−−−−PQLFFEMWNEATGHVSVPFFNGEHIDLHPTSMRYMVNQEINEALKQLDTVC−−WFKPSQTWSESEKEDLKKVMHEILDATGSMMSLVAVLCDQYGISMKEVFK−−−−YWKVS        
fig|101031.3.peg.3817   Bacillus B-14905     TVTGNLVGEVMKEIRGNETQLRFGFDFGVGREAISKYEN−−GRSKVPADISKSIVEKFDD−−−−PKFALAVQHQYTG−−TGPIWLNGPNVDLHRCSVREKTIEELQEALDSIISTS−−LVKPSDAIEHYERKNIMDMVEEAVEAATALANFIAVTTEHLGISYTGVWMDHYKYLQKAGFIK    
fig|581103.5.peg.647   Geobacillus sp. Y4.1MC1                        TQQQLSFEIYESRESISHQEN−−GRYRVQPNISKYFAEKHNN−−−−PWVALEAAAEYTG−−WGPVKLDGEVVDLHRASVAMKTKEELIEALEAIESIC−−VANHPRSIREFDKQHLEEVILQAIDAIVALTQYVAVICIEYGFSWFKMWQKHRAKLQSKGFIR    
fig|235909.3.peg.2106   Geobacillus kaustophilus HTA426                        TQQQLSFEIYESRESVSHQEN−−GRYRVQPNISKYFAEKHNN−−−−PWVALEAAAEYTG−−WGPVKLDGDAVDLHRASVTMKTREELTEALEAIESVC−−VANHPRSIREFDKQRLEEAMMQAIDAIVALTQYVAVICMDYGFSWWKMWQKHRAKLQAKGFIRQ   
fig|458233.11.peg.1057   Macrococcus caseolyticus JCSC5402                           QVADMLLTTKPNICNIEK−−GRRNISSEILMTSYERSDD−−−−PILIKEMSYEFSNGYTTPAPSEVVFDDHRICIKERMLNEIREVIDVLNLYR−−IDKRPEYCSQEDIENVRRIASETQDVIFEAQALIDKIIIDYQLNPQELSRTRNQRYKME        
fig|431943.8.peg.2094   Clostridium kluyveri DSM 555                        TQQELGQMSFLSDKTISAIET−−GRRNLTKDNLRIICKELDN−−−−PFIYFQAASEVTGDVFNINWLDGEAADLHRAAVREKVVEEFDEAIQAISLVK−−TSKNPKTCTMEDVQNIVESIQETIDVYNASAIYIAVMCKEFNLNIQEMFKVQ               
fig|279010.13.peg.1429   Bacillus licheniformis ATCC 14580                                      MVSKMKN−−GTRKMPWDVAETSLKKFDQ−−−−PFFAMGIMNKFSDGCSPPVFTGESVEQHRLAFEEIMVTQATEAIQTLADVS−−FVKNPKLISLEERERIKVVIKELLDVEAWAKNLAALLAKEYNISLKECYKKATITWKAKG       
fig|279010.5.peg.889   Bacillus licheniformis ATCC 14580           SKSLAHLLETKNMTNGQLALDLNVSESMVSKMKN−−GTRKMPWDVAETSLKKFDQ−−−−PFFAMGIMNKFSDGCSPPVFTGESVEQHRLAFEEIMVTQATEAIQTLADVS−−FVKNPKLISLEERERIKVVIKELLDVEAWAKNLAALLAKEYNISLKECYKKATITWKAKG       
fig|393123.3.peg.816   Listeria monocytogenes FSL N1-017     IIKESINASKVMTYVGKIPQKQLADKFWTSRSNVSHMLN−−GRRKMQKDVASTALTNIDS−−−−NLFKLALSHEFSE−−LIPDVFAGQGVNQTPLSYLVMYEQEAGEFNASINEVMKFFVKPANQLTNGERVSARNNLKELIDVLGWGYNLLFYASDYLNIDAYKLMSEQDKIWKQK        
fig|272626.9.peg.1804   Listeria innocua Clip11262     VIKSSINASKVMRYVDDIPQKQLADLLLTSRPNVSHMQT−−GRRRMQQDIATSALNNVQS−−−−NLFKLALSHEFTE−−LIPDVFDGPAINNNSLSYLVMYEQEANEFSANIDEVMKIFVKPASQLTQSERLTARDSLKELLDALGWGYNLLFHASDHLNIDVYQLMSEQDESWKQK        
fig|393121.3.peg.1624   Listeria monocytogenes FSL J2-071     VIKSSINASKVMRYVDDIPQKQLADLLLTSRPNVSHMQT−−GRRRMQQDIATSALNNVQS−−−−NLFKLALSHEFTE−−LIPDVFDGPAINNNSLSYLVMYEQEANEFSANIDEVMKIFVKPASQLTQSERLTARDSLKELLDALGWGYNLLFHASDHLNIDVYQLMSEQDESWKQK        
fig|393121.7.peg.2482   Listeria monocytogenes FSL J2-071     VIKSSINASKVMRYVDDIPQKQLADLLLTSRPNVSHMQT−−GRRRMQQDIATSALNNVQS−−−−NLFKLALSHEFTE−−LIPDVFDGPAINNNSLSYLVMYEQEANEFSANIDEVMKIFVKPASQLTQSERLTARDSLKELLDALGWGYNLLFHASDHLNIDVYQLMSEQDESWKQK        
fig|272626.9.peg.1266   Listeria innocua Clip11262     VIKSSINASKIMKYTGELPQKQLADLLLTSRPNVSHIQT−−GRRKMQQDIAITALNNVQS−−−−NLFKLALSHEFTE−−LVPDVFSGQYVNQNPLSFLVMYEQEANEFSANIDEVMKILVKPANQLTTNERVSARNNLKELIDVLGWGYNLLFFASDYLNIDAYKLISEQDECWKQK        
fig|1169668.3.peg.1761   Enterococcus sp. GMD4E                        TKKEIARQINVSQQSLSDWTTLLNTKPVTLENAQALTDHFRD−−−−SDFTLQVIHEFFG−−LFKSIDGDVYRRDPSSLDKLQMIESDERKQKKQEVEKILLKQVNYLTVDDRQQIIAYAYEFLDEIMVEVTLISALCEILGIDIRKLSEERLSYWVAQGYMK    
fig|1138888.3.peg.1255   Enterococcus faecium E1007                       KTKKEIAKQVNVSQQSLSDWTTPHKTKPVTLENAQVLTDHFRD−−−−SNFTMQVIHEFFG−−LFKSIDSDVYRRDPSSLDKLQIIESDERKQKKQYVEKILLKNVEYLTVDDRQQIISYAYEYLDEIMVEVTLISTLCEILGIDIRKLSEERLSYWINQGYMK    
fig|393125.10.peg.2707   Listeria monocytogenes FSL R2-503     MFQKSVTASQAMQVLAETRTQKELAIDSYVTPALISNQTK−−GKRTVSLEQAEQLIDSYNE−−−−PESTFMFAHEFSNGMIPPLLDG−−LDGHHMTLTACFEAEVTESIKALKQGLEAMSFTLKRGDVNQREAAKKAISEITDVIAAGLTLNTSIAKTFNIDLQQVLTKRDQYYKKSGLVRSCEK
fig|393125.3.peg.3396   Listeria monocytogenes FSL R2-503     MFQKSVTASQAMQVLAETRTQKELAIDSYVTPALISNQTK−−GKRTVSLEQAEQLIDSYNE−−−−PESTFMFAHEFSNGMIPPLLDG−−LDGHHMTLTACFEAEVTESIKALKQGLEAMSFTLKRGDVNQREADKKS                                                
fig|393126.4.peg.2732   Listeria monocytogenes FSL R2-561     MFQKSVTASQAMQVLAETRTQKELAIDSYVTPALISNQTK−−GKRTVSLEQAEQLIDSYNE−−−−PESTFMFAHEFSNGMIPPLFDG−−LDSHHASLTNRFELEVAEAINTLKNGLETMTFNLRKGDMLQREAAKQAISEITDVIASALTLNASIARTFNIDLQQVLNKRDQYYQKSGLVRSCEK
fig|267409.1.peg.1336   Listeria monocytogenes str. 1/2a F6854     MFQKSTSATAAMQVLAETRTQKELAIDSYVTPALISNQIK−−GKRTVSLEQAEQLIDSYNE−−−−PRSTYLFAHEFSNGMIPPLFDG−−LDNHHASLTNRFELEVEEAMNTLKNGLETMTFNLRKGDMLQREAAKQAISEITDVVASALTLNTSIAKAFNIDLQQVLNKRDLYYQKSGLVRSCGK
fig|169963.11.peg.2379   Listeria monocytogenes EGD-e     MFQKSTSATAAMQVLAETRTQKELAIDSYVTPALISNQIK−−GKRTVSLEQAEQLIDSYNE−−−−PRSTYLFAHEFSNGMIPPLFDG−−LDNHHASLTNRFELEVEEAMNTLKNGLETMTFNLRKGDMLQREAAKQAISEITDVVASALTLNASIAIAFNIDLQQVLNKRDLYYQKSGLVRSCGK
fig|653938.3.peg.2538   Listeria monocytogenes 08-5578     MFQKSTSATAAMQVLAETRTQKELAIDSYVTPALISNQIR−−GKRTVSLEQAEHLIDSYNE−−−−PESTYLFAHEFSNGMIPPLFDG−−LDNHHASLTNRFELEVEEAINTLKNGLETMTYSLRKGDMLQREAAKQAISEITDVVASALTLNTSIAKAFNIDLQQVLNKRDLYYQKSGLVRSCGK
fig|401650.3.peg.2310   Listeria monocytogenes Aureli 1997     MFQKSTSATSAMQVLAETRTQKELAIDSFVTPALISNQLK−−GKRTVSLEQAEQLIDSYNE−−−−PESTYLFAHEFSNGMIPPLLDG−−LDNHHASLTNRFELEVEEAINTLKNGLETMTYSLRKGDMLQREAAKQAISEITDVVASALTLNTSIAKAFNIDLQQVLNKRDLYYQKSGLVRSCGK
fig|393133.3.peg.2069   Listeria monocytogenes 10403S     MFQRSISAPTAMQVLAETRTQKELAIDSYVTPALISNQIK−−GKRTVSLEQAEQLIDSYNE−−−−PESTYLFAHEFSNGMIPPLFDG−−LDNHHASLTNRFELEVEEAINTLKNGLETMTYSLRKGDMLQREAAKQAISEITDVVASALTLNTSIAKAFNIDLQQVLNKRDLYYQKSGLVRSCGK
fig|393117.11.peg.1627   Listeria monocytogenes FSL J1-194     MFQKSTYAQNAMRVLAETHSQKELAIDSYVTAALISNQAK−−GKRTVSLEQAEQLIDSYNE−−−−PESTYLFAHEFSNGMIPPLFDG−−LDNHHASLTNRFELEVEEAINTLKNGLETMTYSLRKGDMLQREAAKQAISEITDVVASALTLNASIAKAFNIDLQQVLNKRDQYYQKSGLVRSCGK
fig|267410.6.peg.1019   Listeria monocytogenes str. 4b H7858     MFQKSTYAQNAMRVLAETRTQKELAIDSYVTPALISNQTK−−GKRTVSLEQAEQLIDSYNE−−−−PESTYLFAHEFSNGMIPPLFDG−−LDNHHASLTNRFELEVEEAINTLKNGLETMTYSLRKGDMLQREAAKQAISEITDVVASALTLNASIAKAFNIDLQQVLNKRDQYYQKSGLVRSCRK
fig|272626.9.peg.2473   Listeria innocua Clip11262     MFQKSISAPTAMQVLAETRTQKELAIDSYVTPALISNQLK−−GKRTVSLEQAEHLIDSYNE−−−−PESTYLFAHEFSNGMIPPLFDG−−LDNHHASLTNRFELEVEEAINTLKNGLETMTFNLRKGDMIQREAAKQAISEITDVVASALTLNASIARTFNIDLQQVLNKRDQYYQKSGLVRSCGK
fig|393125.10.peg.3002   Listeria monocytogenes FSL R2-503     MFQKSTSAPTAMQVLAETRTQKELAIDSYVTPALISNQLK−−GKRTVSLEQAEQLIDSYNE−−−−PESTYLFAHEFSNGMIPPLFDG−−LDNHHASLTNRFELEVEEAVNALKNGIETMTFNLRKGDMLQREAAKQAISEITDVIATALTLNTSIARTFNIDLQQVLSKRDQYYKKLGVVKN   
fig|393125.3.peg.3369   Listeria monocytogenes FSL R2-503     MFQKSTSAPTAMQVLAETRTQKELAIDSYVTPALISNQLK−−GKRTVSLEQAEQLIDSYNE−−−−PESTYLFAHEFSNGMIPPLFDG−−LDNHHASLTNRFELEVEEAVNALKNGIETMTFNLRKGDMLQREAAKQAISEITDVIATALTLNTSIARTFNIDLQQVLSKRDQYYK          
fig|552536.6.peg.2927   Listeria monocytogenes HCC23     MFQKSISATAAMQVLAETRTQKELAIDSYVTPALISNQLK−−GKRTVSLEQAEQLIDSYNE−−−−PESTYLFAHEFSNGMIPPLLDG−−LDNHHASLTNRFELEVEEAINTLKNGLETMTFNLRKGDMLQREAAKQAIAEIADVIATALTLNTSIAKTFSIDLQQILEKRDKFYQKEGLIQSRNK
fig|401650.3.peg.2662   Listeria monocytogenes Aureli 1997     MFQKSTYAQNAMQVLAETHSQKELAIDSYVTPALISNQLK−−GKRTVSLEQAEQLIDSYNE−−−−PQSTYLFAHEFSNGMIPPLLNG−−LDNHHASLTCRFELEVIEAINTLRNGLDTMTFNLRKGDMLQREAAKQAIAEIADVIATALTLNTSIAKTFSIDLQQILEKRDKFYQKEGLIQSRNK
fig|393121.3.peg.2588   Listeria monocytogenes FSL J2-071     MFQKSTSATSAMQVLAETRTQKELAIDSYVTPALISNQLK−−GKRTVSLEQAEQLIDSYNE−−−−PQSTYLFAHEFSNGMIPPLLDG−−LDSHHAALTCRFELEVTEAVNALKSGLETMTFNLRKGDMLQREAAKQAISEITDVIATALTLNTSIAKAFNINLQQILESRDKFYQKNGLVKE   
fig|393121.7.peg.3154   Listeria monocytogenes FSL J2-071                MQVLAETRTQKELAIDSYVTPALISNQLK−−GKRTVSLEQAEQLIDSYNE−−−−PQSTYLFAHEFSNGMIPPLLDG−−LDSHHAALTCRFELEVTEAVNALKSGLETMTFNLRKGDMLQREAAKQAISEITDVIATALTLNTSIAKAFNINLQQILESRDKFYQKNGLVKE   
fig|272626.9.peg.88   Listeria innocua Clip11262     MFQKSTSAPTAMQVLAETRTQKELAIDSYVTPALISNQLK−−GKRTVSLEQAEQLIDSYNE−−−−PESTYLFAHEFSNGMIPPLFDG−−LDSHHAALTCRFELEVTEAVNALKSGLETMTFNLRKGDMLQREAAKQAISEITDVIATALTLNTSIAKAFNINLQQILESRDKFYQKNGLVKE   
fig|393121.7.peg.3161   Listeria monocytogenes FSL J2-071                MQVLAETRTQKELAIDSYVTPALISNQLK−−GKRTVSLEQAEQLIDSYNE−−−−PQSTYLFAHEFSNGMIPPLLNG−−LDNHHASLTCRFELEVTEAVNALKSGLETMTFNLRKGDMLQREAAKQAISEITDVIATALTLNTSIAKAFNINLQQILESRDKFYQKNGLVKE   
fig|401650.3.peg.2305   Listeria monocytogenes Aureli 1997     MFQKSTSATAAMQVLAETRTQKELAIDSYVTPALISNQIK−−GKRTVSLEQAEQLIDSYNE−−−−PQSTYLFAHEFSNGMIPPLLNG−−LDNHHASLTCRFELEVTEAVNALKSGLETMTFNLRKGDMLQREAAKQAISEITDVIATALTLNTSIAKAFNINLQQILESRDKFYQKNGLVKE   
fig|393121.3.peg.2596   Listeria monocytogenes FSL J2-071     MFQKSTSATAAMQVLAETRTQKELAIDSYVTPALISNQLK−−GKRTVSLEQAEQLIDSYNE−−−−PQSTYLFAHEFSNGMIPPLLNG−−LDNHHASLTCRFELEVTEAVNALKSGLETMTFNLRKGDMLQREAAKQAISEITDVIATALTLNTSIAKAFNINLQQILESRDKFYQKNGLVKE