(in new window)

SEED user:
Focus protein ID:

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      

Alignment 00013735

fig|634504.3.peg.368   Bartonella grahamii as4aup                                                              EAKRDFSNWIKDRIIKYNLEEGIDYILTLAKTGERQNVVLK−−−EYYL−−−−−−−−−−−TLNV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AKELSMLE−−−−−−−−−−−−−−−−−−−NN−−−−−−K−−−−−−−−KGR−−−−−E−−−−−−−−−−−−−−−−−−−−−−ARLYFIKCERLL−−−−KQ−−VT−−TP−−−−−−QVDYSKPEALLGVLNHLQSQIEQKDHVIAEL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−APKAKALDGLKRSDG−−−−−−−−−−−−LFGLIEAA−−−−−−−−−−−KMLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VRPKELTDYLRKH−−−−−−−−−−−−−−−−−−−−−−−−DWVYRRAPGAPLLPYQDKIKKGFMDCPAIT−−−−−−−−−−−−−−IQRPDGTEKVLPSTK−−−−ITPKG                                
fig|634452.3.peg.268   Acetobacter pasteurianus IFO 3283-01                                                                 GTPFWVH−−−−A−−−−−−−DVCAVLEIAQPH−−−−−−HAANRL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DDDEK−−−−−−GRAIVTTLGGP−−−−−−−−−−−−−−−−−−−−QEMTV−−−−−−−INESGLWSLV−−−−−−−−−−−−−−−−LTS−−−−−−R−−−−−−−−KPA−−−−−A−−−−−−−−−−−−−−−−−−−−−−K−−−−−RFKKWI−−−−TS−−EV−−IP−−−−−−SIR−−KTGGY−−−−−MVAA−−−−−−−−−−P−−−−−−−−−−−−−−−−−−−−−−−DETPEELALRAMTILQAT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VERQKTQLAVAQ−−−−−−−−PK−−−−−−−−−−−−AEA−−HDRIAG−−−−−−−ADG−−−−−−−−−−SLSITEAA−−−−−−−−−−−KV−−−L−−−−−−−−−−−−−−−−−−−−Q−−−−−−−−−−−−−−−−−−−−−VRPKDLFDWLSHN−−−GWIY−−−−KRPGSPSW−−−LGY−−−−−−−−−−−QSHTTNRDLEHKITTI−−LR−−−−−−−−PDGSEKV−−−SEQVR−−−−ITPK−−−−−−−−GIAKLAKLM                
fig|634458.3.peg.269   Acetobacter pasteurianus IFO 3283-01-42C                                                                 GTPFWVH−−−−A−−−−−−−DVCAVLEIAQPH−−−−−−HAANRL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DDDEK−−−−−−GRAIVTTLGGP−−−−−−−−−−−−−−−−−−−−QEMTV−−−−−−−INESGLWSLV−−−−−−−−−−−−−−−−LTS−−−−−−R−−−−−−−−KPA−−−−−A−−−−−−−−−−−−−−−−−−−−−−K−−−−−RFKKWI−−−−TS−−EV−−IP−−−−−−SIR−−KTGGY−−−−−MVAA−−−−−−−−−−P−−−−−−−−−−−−−−−−−−−−−−−DETPEELALRAMTILQAT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VERQKTQLAVAQ−−−−−−−−PK−−−−−−−−−−−−AEA−−HDRIAG−−−−−−−ADG−−−−−−−−−−SLSITEAA−−−−−−−−−−−KV−−−L−−−−−−−−−−−−−−−−−−−−Q−−−−−−−−−−−−−−−−−−−−−VRPKDLFDWLSHN−−−GWIY−−−−KRPGSPSW−−−LGY−−−−−−−−−−−QSHTTNRDLEHKITTI−−LR−−−−−−−−PDGSEKV−−−SEQVR−−−−ITPK−−−−−−−−GIAKLAKLM                
fig|1005483.3.peg.3020   Escherichia coli FRIK920                                                         DSIIVVAQLSPEFTA−−−−R−−−−−−−−−−−LVDR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WREL−−−−−−−−−−−−−−−−EGA−−−−−−T−−−−−−−−A−−−−−−−−−−−−−−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IP−−−−QTF−−−−−−−−−−−−−−−−−−−−−−−−−−SE−−−−−−−−−−−−−−−−−−−−−−−ALR−−−−−−−−−−−−LAA−−DLEDQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KA−−−−−−−ELEKQLALAA−−−−−−−−PK−−−−−−−−−−−−VEF−−ADRVGE−−−−−−−−AS−−−−−−−−−−GILIGNFA−−−−−−−−−−−KV−−−V−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−IGPNKRFAWMRDH−−−KIL−−−−−−IASGARRN−−−VPM−−−−−−−−−−−QEYMDRGYFTVK−−−−E−−TA−−−−−−−−VNTNHGIQISFTTK−−−−ITGR−−−−−−−−GQQWLTRKLL               
fig|1005494.3.peg.2681   Escherichia coli PA10                                                         DSIIVVAQLSPEFTA−−−−R−−−−−−−−−−−LVDR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WREL−−−−−−−−−−−−−−−−EGA−−−−−−T−−−−−−−−A−−−−−−−−−−−−−−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IP−−−−QTF−−−−−−−−−−−−−−−−−−−−−−−−−−SE−−−−−−−−−−−−−−−−−−−−−−−ALR−−−−−−−−−−−−LAA−−DLEDQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KA−−−−−−−ELEKQLALAA−−−−−−−−PK−−−−−−−−−−−−VEF−−ADRVGE−−−−−−−−AS−−−−−−−−−−GILIGNFA−−−−−−−−−−−KV−−−V−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−IGPNKRFAWMRDH−−−KIL−−−−−−IASGARRN−−−VPM−−−−−−−−−−−QEYMDRGYFTVK−−−−E−−TA−−−−−−−−VNTNHGIQISFTTK−−−−ITGR−−−−−−−−GQQWLTRKLL               
fig|478004.5.peg.4158   Escherichia coli O157:H7 str. EC4401                                                         DSIIVVAQLSPEFTA−−−−R−−−−−−−−−−−LVDR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WREL−−−−−−−−−−−−−−−−EGA−−−−−−T−−−−−−−−A−−−−−−−−−−−−−−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IP−−−−QTF−−−−−−−−−−−−−−−−−−−−−−−−−−SE−−−−−−−−−−−−−−−−−−−−−−−ALR−−−−−−−−−−−−LAA−−DLEDQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KA−−−−−−−ELEKQLALAA−−−−−−−−PK−−−−−−−−−−−−VEF−−ADRVGE−−−−−−−−AS−−−−−−−−−−GILIGNFA−−−−−−−−−−−KV−−−V−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−IGPNKRFAWMRDH−−−KIL−−−−−−IASGARRN−−−VPM−−−−−−−−−−−QEYMDRGYFTVK−−−−E−−TA−−−−−−−−VNTNHGIQISFTTK−−−−ITGR−−−−−−−−GQQWLTRKLL               
fig|585396.4.peg.3467   Escherichia coli O111:H- str. 11128                                                                 MSPEFTA−−−−R−−−−−−−−−−−LVDR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WREL−−−−−−−−−−−−−−−−EGA−−−−−−T−−−−−−−−A−−−−−−−−−−−−−−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IP−−−−QTF−−−−−−−−−−−−−−−−−−−−−−−−−−SE−−−−−−−−−−−−−−−−−−−−−−−ALR−−−−−−−−−−−−LAA−−DLEDQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KA−−−−−−−ELEKQLALAA−−−−−−−−PK−−−−−−−−−−−−VEF−−ADRVGE−−−−−−−−AS−−−−−−−−−−GILIGNFA−−−−−−−−−−−KV−−−V−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−IGPNKRFAWMRDH−−−KIL−−−−−−IASGARRN−−−VPM−−−−−−−−−−−QEYMDRGYFTVK−−−−E−−TA−−−−−−−−VNTNHGIQISFTTK−−−−ITGR−−−−−−−−GQQWLTRKLL               
fig|670904.4.peg.698   Escherichia coli OK1180                                                                 MSPEFTA−−−−R−−−−−−−−−−−LVDR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WREL−−−−−−−−−−−−−−−−EGA−−−−−−T−−−−−−−−A−−−−−−−−−−−−−−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IP−−−−QTF−−−−−−−−−−−−−−−−−−−−−−−−−−SE−−−−−−−−−−−−−−−−−−−−−−−ALR−−−−−−−−−−−−LAA−−DLEDQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KA−−−−−−−ELEKQLALAA−−−−−−−−PK−−−−−−−−−−−−VEF−−ADRVGE−−−−−−−−AS−−−−−−−−−−GILIGNFA−−−−−−−−−−−KV−−−V−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−IGPNKRFAWMRDH−−−KIL−−−−−−IASGARRN−−−VPM−−−−−−−−−−−QEYMDRGYFTVK−−−−E−−TA−−−−−−−−VNTNHGIQISFTTK−−−−ITGR−−−−−−−−GQQWLTRKLL               
fig|444453.5.peg.5610   Escherichia coli O157:H7 str. EC4076                                                         DSIIVVAQLSPEFTA−−−−R−−−−−−−−−−−LVDR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WREL−−−−−−−−−−−−−−−−EGA−−−−−−T−−−−−−−−A−−−−−−−−−−−−−−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IP−−−−QTF−−−−−−−−−−−−−−−−−−−−−−−−−−SE−−−−−−−−−−−−−−−−−−−−−−−ALR−−−−−−−−−−−−LAA−−DLEDQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KA−−−−−−−ELEKQLALAA−−−−−−−−PK−−−−−−−−−−−−VEF−−ADRVGE−−−−−−−−AS−−−−−−−−−−GILIGNFA−−−−−−−−−−−KV−−−V−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−IGPNKRFAWMRDH−−−KIL−−−−−−IASGARRN−−−VPM−−−−−−−−−−−QEYMDRGYFTVK−−−−E−−TA−−−−−−−−VNTNHGIQISFTTK−−−−ITGR−−−−−−−−GQQWLTE                  
fig|1005483.3.peg.3749   Escherichia coli FRIK920                                                         DSIIVVAQLSPEFTA−−−−R−−−−−−−−−−−LVDR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WREL−−−−−−−−−−−−−−−−EGA−−−−−−T−−−−−−−−A−−−−−−−−−−−−−−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IP−−−−QTF−−−−−−−−−−−−−−−−−−−−−−−−−−SE−−−−−−−−−−−−−−−−−−−−−−−ALR−−−−−−−−−−−−LAA−−DLEDQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KA−−−−−−−ELEKQLALAA−−−−−−−−PK−−−−−−−−−−−−VEF−−ADRVGE−−−−−−−−DS−−−−−−−−−−GILIGNFA−−−−−−−−−−−KV−−−V−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−IGPNKLFAWMRDH−−−KIL−−−−−−IASGARRN−−−VPM−−−−−−−−−−−QEYMDRGYFTVK−−−−E−−TA−−−−−−−−VNTNHGIQISFTTK−−−−ITGR−−−−−−−−GKQWLTRKLL               
fig|570506.3.peg.4347   Escherichia coli O157:H7 str. FRIK966                                                         DSIIVVAQLSPEFTA−−−−R−−−−−−−−−−−LVDR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WREL−−−−−−−−−−−−−−−−EGA−−−−−−T−−−−−−−−A−−−−−−−−−−−−−−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IP−−−−QTF−−−−−−−−−−−−−−−−−−−−−−−−−−SE−−−−−−−−−−−−−−−−−−−−−−−ALR−−−−−−−−−−−−LAA−−DLEDQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KA−−−−−−−ELEKQLALAA−−−−−−−−PK−−−−−−−−−−−−VEF−−ADRVGE−−−−−−−−DS−−−−−−−−−−GILIGNFA−−−−−−−−−−−KV−−−V−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−IGPNKRFAWMRDH−−−KIL−−−−−−IASGARRN−−−VPM−−−−−−−−−−−QEYMDRGYFTVK−−−−E−−TA−−−−−−−−VNTNHGIQISFTTK−−−−ITGR−−−−−−−−GKQWLTRKLL               
fig|701177.3.peg.3274   Escherichia coli O55:H7 str. CB9615                                                         DSIIVVAQLSPEFTA−−−−R−−−−−−−−−−−LVDR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WREL−−−−−−−−−−−−−−−−EGA−−−−−−T−−−−−−−−A−−−−−−−−−−−−−−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IP−−−−QTF−−−−−−−−−−−−−−−−−−−−−−−−−−SE−−−−−−−−−−−−−−−−−−−−−−−ALR−−−−−−−−−−−−LAA−−DLEDQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KA−−−−−−−ELEKQLALAA−−−−−−−−PK−−−−−−−−−−−−VEF−−ADRVGE−−−−−−−−AS−−−−−−−−−−GILIGNFA−−−−−−−−−−−KV−−−V−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−IGPNKLFAWMRDH−−−KIL−−−−−−IASGARRN−−−VPM−−−−−−−−−−−QEYMDRGYFTVK−−−−E−−TA−−−−−−−−VNTNHGIQISFTTK−−−−ITGR−−−−−−−−GQQWLTRKLL               
fig|585396.4.peg.1191   Escherichia coli O111:H- str. 11128                                                                 LSPEFTA−−−−R−−−−−−−−−−−LVDR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WREL−−−−−−−−−−−−−−−−EGA−−−−−−T−−−−−−−−A−−−−−−−−−−−−−−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IP−−−−QTF−−−−−−−−−−−−−−−−−−−−−−−−−−SE−−−−−−−−−−−−−−−−−−−−−−−ALR−−−−−−−−−−−−LAA−−DLEDQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KA−−−−−−−ELEKQLALAA−−−−−−−−PK−−−−−−−−−−−−VEF−−ADRVGE−−−−−−−−AS−−−−−−−−−−GILIGNFA−−−−−−−−−−−KV−−−V−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−IGPNKLFAWMRDH−−−KIL−−−−−−IASGARRN−−−VPM−−−−−−−−−−−QEYMDRGYFTVK−−−−E−−TA−−−−−−−−VNTNHGIQISFTTK−−−−ITGR−−−−−−−−GQQWLTRKLL               
fig|155864.1.peg.1280   Escherichia coli O157:H7 EDL933                                                                 LSPEFTA−−−−R−−−−−−−−−−−LVDR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WREL−−−−−−−−−−−−−−−−EGA−−−−−−T−−−−−−−−A−−−−−−−−−−−−−−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IP−−−−QTF−−−−−−−−−−−−−−−−−−−−−−−−−−SE−−−−−−−−−−−−−−−−−−−−−−−ALR−−−−−−−−−−−−LAA−−DLEDQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KA−−−−−−−ELEKQLALAA−−−−−−−−PK−−−−−−−−−−−−VEF−−ADRVGE−−−−−−−−AS−−−−−−−−−−GILIGNFA−−−−−−−−−−−KV−−−V−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−IGPNKLFAWMRDH−−−KIL−−−−−−IASGARRN−−−VPM−−−−−−−−−−−QEYMDRGYFTVK−−−−E−−TA−−−−−−−−VNTNHGIQISFTTK−−−−ITGR−−−−−−−−GQQWLTRKLL               
fig|340186.5.peg.3884   Escherichia coli E110019                                                         DSIIVVAQLSPEFTA−−−−R−−−−−−−−−−−LVDR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WREL−−−−−−−−−−−−−−−−EGA−−−−−−T−−−−−−−−A−−−−−−−−−−−−−−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IP−−−−QTF−−−−−−−−−−−−−−−−−−−−−−−−−−SE−−−−−−−−−−−−−−−−−−−−−−−ALR−−−−−−−−−−−−LAA−−DLEDQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KA−−−−−−−ELEKQLALAA−−−−−−−−PK−−−−−−−−−−−−VEF−−ADRVGE−−−−−−−−SS−−−−−−−−−−GILIGNFA−−−−−−−−−−−KV−−−V−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−IGPNKLFAWMRDH−−−KIL−−−−−−IASGSRRN−−−VPM−−−−−−−−−−−QEYMDRGYFTVK−−−−E−−TA−−−−−−−−VNTNHGIQISFTTK−−−−ITGR−−−−−−−−GQQWLTRKLL               
fig|1165952.3.peg.5504   Escherichia coli O26:H11 str. CVM10030                                                         DSIIVVAQLSPEFTA−−−−R−−−−−−−−−−−LVDR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WREL−−−−−−−−−−−−−−−−EGA−−−−−−T−−−−−−−−A−−−−−−−−−−−−−−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IP−−−−QTF−−−−−−−−−−−−−−−−−−−−−−−−−−SE−−−−−−−−−−−−−−−−−−−−−−−ALR−−−−−−−−−−−−LAA−−DLEDQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KA−−−−−−−ELEKQLALAA−−−−−−−−PK−−−−−−−−−−−−VEF−−ADRVGE−−−−−−−−AS−−−−−−−−−−GILIGNFA−−−−−−−−−−−KV−−−V−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−IGPNKLFAWMRDH−−−KIL−−−−−−IASGSRRN−−−VPM−−−−−−−−−−−QEYMDRGYFTVK−−−−E−−TA−−−−−−−−VNTNHGIQISFTTK−−−−ITGR−−−−−−−−GQQWLTRKLL               
fig|754093.3.peg.1681   Shigella dysenteriae 1617                                                         DSIIVVAQLSPEFTA−−−−R−−−−−−−−−−−LVDR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WREL−−−−−−−−−−−−−−−−EGA−−−−−−T−−−−−−−−A−−−−−−−−−−−−−−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IP−−−−QTF−−−−−−−−−−−−−−−−−−−−−−−−−−SE−−−−−−−−−−−−−−−−−−−−−−−ALR−−−−−−−−−−−−LAA−−DLEDQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KA−−−−−−−ELEKQLALAA−−−−−−−−PK−−−−−−−−−−−−VEF−−ADRVSE−−−−−−−−AS−−−−−−−−−−GILIGNFA−−−−−−−−−−−KV−−−V−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−IGPNKLFAWMRDH−−−KIL−−−−−−IASGSRRN−−−VPM−−−−−−−−−−−QEYMDRGYFTVK−−−−E−−TA−−−−−−−−VNTNHGIQISFTTK−−−−ITGR−−−−−−−−GQQWLTRKLL               
fig|1086030.3.peg.292   Shigella flexneri 5a str. M90T                                                                 LSPEFTA−−−−R−−−−−−−−−−−LVDR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WREL−−−−−−−−−−−−−−−−EES−−−−−−A−−−−−−−−V−−−−−−−−−−−−−−−−−N−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IP−−−−KTL−−−−−−−−−−−−−−−−−−−−−−−−−−PE−−−−−−−−−−−−−−−−−−−−−−−ALR−−−−−−−−−−−−LAA−−DLAEQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KM−−−−−−−QLENQLAIAA−−−−−−−−PK−−−−−−−−−−−−VEF−−ADRVGE−−−−−−−−AS−−−−−−−−−−GILIGNFA−−−−−−−−−−−KV−−−V−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−IGPNKLFAWMRDH−−−KIL−−−−−−IASGTRRN−−−VPM−−−−−−−−−−−QEYMDRGYFTVK−−−−E−−TA−−−−−−−−VNTNHGIQISFTTK−−−−ITGR−−−−−−−−GQQWLTRKLL               
fig|585397.7.peg.2551   Escherichia coli ED1a                                                         DSIIVVAQLSPEFTA−−−−R−−−−−−−−−−−LVDR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WREL−−−−−−−−−−−−−−−−EET−−−−−−A−−−−−−−−V−−−−−−−−−−−−−−−−−N−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IP−−−−KTL−−−−−−−−−−−−−−−−−−−−−−−−−−PE−−−−−−−−−−−−−−−−−−−−−−−ALR−−−−−−−−−−−−LAA−−DLAEQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KM−−−−−−−QLENQLAIAA−−−−−−−−PK−−−−−−−−−−−−VEF−−ADRVGE−−−−−−−−AS−−−−−−−−−−GILIGNYA−−−−−−−−−−−KV−−−V−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−IGPNKLFAWMRDH−−−KIL−−−−−−IASGARRN−−−VPM−−−−−−−−−−−QEYMERGYFTVK−−−−E−−TA−−−−−−−−VNTNHGIQISFTTK−−−−ITGR−−−−−−−−GQQWLTRKLL               
fig|1165952.3.peg.810   Escherichia coli O26:H11 str. CVM10030                                                                 LSPEFTA−−−−R−−−−−−−−−−−LVDR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WREL−−−−−−−−−−−−−−−−EET−−−−−−A−−−−−−−−V−−−−−−−−−−−−−−−−−N−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IP−−−−KTL−−−−−−−−−−−−−−−−−−−−−−−−−−PE−−−−−−−−−−−−−−−−−−−−−−−ALR−−−−−−−−−−−−LAA−−DLAEQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KM−−−−−−−QLENQLAIAA−−−−−−−−PK−−−−−−−−−−−−VEF−−ADRVGE−−−−−−−−AS−−−−−−−−−−GILIGNFA−−−−−−−−−−−KV−−−V−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−IGPNKLFAWMRDH−−−KIL−−−−−−IASGSRRN−−−VPM−−−−−−−−−−−QEYMDRGYFTVK−−−−E−−TA−−−−−−−−VNTNHGIQISFTTK−−−−ITGR−−−−−−−−GQQWLTRKLL               
fig|591020.3.peg.345   Shigella flexneri 2002017                                                                 LSPEFTA−−−−R−−−−−−−−−−−LVDR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WREL−−−−−−−−−−−−−−−−EET−−−−−−A−−−−−−−−V−−−−−−−−−−−−−−−−−N−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IP−−−−KTL−−−−−−−−−−−−−−−−−−−−−−−−−−PE−−−−−−−−−−−−−−−−−−−−−−−ALR−−−−−−−−−−−−LAA−−DLAEQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KM−−−−−−−QLENQLAIAA−−−−−−−−PK−−−−−−−−−−−−VEF−−ADRVGE−−−−−−−−AS−−−−−−−−−−GILIGNFA−−−−−−−−−−−KV−−−V−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−IGPNKLFAWMRDH−−−KIL−−−−−−IASGSRRN−−−VPM−−−−−−−−−−−QEYMDRGYFTVK−−−−E−−TA−−−−−−−−VNTNHGIQISFTTK−−−−ITGR−−−−−−−−GQQWLTRKLL               
fig|574521.7.peg.1022   Escherichia coli O127:H6 str. E2348/69                                                                 LSPEFTA−−−−R−−−−−−−−−−−LVDR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WREL−−−−−−−−−−−−−−−−EEA−−−−−−A−−−−−−−−V−−−−−−−−−−−−−−−−−N−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IP−−−−KTL−−−−−−−−−−−−−−−−−−−−−−−−−−PE−−−−−−−−−−−−−−−−−−−−−−−ALR−−−−−−−−−−−−LAA−−DLAEQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KM−−−−−−−QLENQLAIAA−−−−−−−−PK−−−−−−−−−−−−VEF−−ADRVGE−−−−−−−−AS−−−−−−−−−−GILIGNFA−−−−−−−−−−−KV−−−V−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−IGPNKLFAWMRDH−−−KIL−−−−−−IASGSRRN−−−VPM−−−−−−−−−−−QEYMDRGYFTVK−−−−E−−TA−−−−−−−−VNTNHGIQISFTTK−−−−ITGC−−−−−−−−GQQWLTRKLL               
fig|444453.5.peg.1779   Escherichia coli O157:H7 str. EC4076                                                                 LSPEFTA−−−−R−−−−−−−−−−−LVDR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WREL−−−−−−−−−−−−−−−−EEA−−−−−−A−−−−−−−−V−−−−−−−−−−−−−−−−−N−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IP−−−−KTL−−−−−−−−−−−−−−−−−−−−−−−−−−PE−−−−−−−−−−−−−−−−−−−−−−−ALR−−−−−−−−−−−−LAA−−DLAEQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KM−−−−−−−QLENQLAIAA−−−−−−−−PK−−−−−−−−−−−−VEF−−ADRVGE−−−−−−−−AS−−−−−−−−−−GILIGNFA−−−−−−−−−−−KV−−−V−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−IGPNKLFAWMRDH−−−KIL−−−−−−IASGARRN−−−VPM−−−−−−−−−−−QEYMDRGYFTVK−−−−E−−TA−−−−−−−−VNTNHGIQISFTTK−−−−ITGR−−−−−−−−GQQWLTRKLL               
fig|478004.5.peg.5428   Escherichia coli O157:H7 str. EC4401                                                                 LSPEFTA−−−−R−−−−−−−−−−−LVDR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WREL−−−−−−−−−−−−−−−−EEA−−−−−−A−−−−−−−−V−−−−−−−−−−−−−−−−−N−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IP−−−−KTL−−−−−−−−−−−−−−−−−−−−−−−−−−PE−−−−−−−−−−−−−−−−−−−−−−−ALR−−−−−−−−−−−−LAA−−DLAEQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KM−−−−−−−QLENQLAIAA−−−−−−−−PK−−−−−−−−−−−−VEF−−ADRVGE−−−−−−−−AS−−−−−−−−−−GILIGNFA−−−−−−−−−−−KV−−−V−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−IGPNKLFAWMRDH−−−KIL−−−−−−IASGARRN−−−VPM−−−−−−−−−−−QEYMDRGYFTVK−−−−E−−TA−−−−−−−−VNTNHGIQISFTTK−−−−ITGR−−−−−−−−GQQWLTRKLL               
fig|405955.13.peg.2602   Escherichia coli APEC O1                                                                 LSPEFTA−−−−R−−−−−−−−−−−LVDR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WREL−−−−−−−−−−−−−−−−EEA−−−−−−A−−−−−−−−V−−−−−−−−−−−−−−−−−N−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IP−−−−KTL−−−−−−−−−−−−−−−−−−−−−−−−−−PE−−−−−−−−−−−−−−−−−−−−−−−ALR−−−−−−−−−−−−LAA−−DLAEQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KM−−−−−−−QLENQLAIVA−−−−−−−−PK−−−−−−−−−−−−VEF−−ADRVGE−−−−−−−−AS−−−−−−−−−−GILIGNFA−−−−−−−−−−−KV−−−V−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−IGQNKLFAWMRDH−−−KIL−−−−−−IASGSRRN−−−VPM−−−−−−−−−−−QEYMDRGYFTVK−−−−E−−TA−−−−−−−−VNTNHGIQISFTTK−−−−ITGR−−−−−−−−GQQWLTRKLL               
fig|1116187.3.peg.1466   Escherichia coli P0304816.11                                                                 LSPEFTA−−−−R−−−−−−−−−−−LVDR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WREL−−−−−−−−−−−−−−−−EEA−−−−−−A−−−−−−−−V−−−−−−−−−−−−−−−−−N−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IP−−−−KTL−−−−−−−−−−−−−−−−−−−−−−−−−−PE−−−−−−−−−−−−−−−−−−−−−−−ALR−−−−−−−−−−−−LAA−−DLAEQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KM−−−−−−−QLENQLAIAA−−−−−−−−PK−−−−−−−−−−−−VEF−−ADRVGE−−−−−−−−AS−−−−−−−−−−GILIGNFA−−−−−−−−−−−KV−−−V−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−IGPNKLFAWMRDH−−−KIL−−−−−−IASGSRRN−−−VPM−−−−−−−−−−−QEYMDRGYFTVK−−−−E−−TA−−−−−−−−VNTNHGIQISFTTK−−−−ITGR−−−−−−−−GQQWLTRKLL               
fig|585055.8.peg.2668   Escherichia coli 55989                                                                 LSPEFTA−−−−R−−−−−−−−−−−LVDR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WREL−−−−−−−−−−−−−−−−EEA−−−−−−A−−−−−−−−V−−−−−−−−−−−−−−−−−N−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IP−−−−KTL−−−−−−−−−−−−−−−−−−−−−−−−−−PE−−−−−−−−−−−−−−−−−−−−−−−ALR−−−−−−−−−−−−LAA−−DLAEQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KM−−−−−−−QLENQLAIAA−−−−−−−−PK−−−−−−−−−−−−VEF−−ADRVGE−−−−−−−−AS−−−−−−−−−−GILIGNYA−−−−−−−−−−−KV−−−V−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−IGPNKLFAWMRDH−−−KIL−−−−−−IASGSRRN−−−VPM−−−−−−−−−−−QEYMDRGYFTVK−−−−E−−TA−−−−−−−−VNTNHGIQISFTTK−−−−ITGR−−−−−−−−GQQWLTRKLL               
fig|340186.5.peg.2858   Escherichia coli E110019                                                         DSIIVVAQLSPEFTA−−−−R−−−−−−−−−−−LVDR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WREL−−−−−−−−−−−−−−−−EDA−−−−−−A−−−−−−−−V−−−−−−−−−−−−−−−−−N−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IP−−−−KTL−−−−−−−−−−−−−−−−−−−−−−−−−−PE−−−−−−−−−−−−−−−−−−−−−−−ALR−−−−−−−−−−−−LAA−−DLAEQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KM−−−−−−−QLENQLAIAA−−−−−−−−PK−−−−−−−−−−−−VEF−−ADRVGE−−−−−−−−AS−−−−−−−−−−GILIGNYA−−−−−−−−−−−KV−−−V−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−IGPNKLFAWMREH−−−KIL−−−−−−IASGSRRN−−−VPM−−−−−−−−−−−QEYMDRGYFTVK−−−−E−−TA−−−−−−−−VNTNHGIQISFTTK−−−−ITGR−−−−−−−−GQQWLTRKLL               
fig|1165952.3.peg.1586   Escherichia coli O26:H11 str. CVM10030                                                                  SPAFRL−−−−K−−−−−−−VNQTFIDYR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AGRL−−−−−−−−−−−−−−−−QPA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IP−−−−KSL−−−−−−−−−−−−−−−−−−−−−−−−−−PE−−−−−−−−−−−−−−−−−−−−−−−ALR−−−−−−−−−−−−LAA−−DLAEQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KQ−−−−−−−RLEQKMLMDA−−−−−−−−PK−−−−−−−−−−−−VEF−−AERVAT−−−−−−−−AS−−−−−−−−−−GVLIGNYA−−−−−−−−−−−KV−−−L−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−LGQNYLFTWLRDN−−−GIL−−−−−−IATGERRN−−−VPK−−−−−−−−−−−QEYISRGYFTLK−−−−E−−TV−−−−−−−−IDTSNGSRISFTTR−−−−ITGK−−−−−−−−GQQWLMKRLL               
fig|585396.4.peg.5840   Escherichia coli O111:H- str. 11128                                                                  SPAFRL−−−−K−−−−−−−VNQTFIDYR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AGRL−−−−−−−−−−−−−−−−QPA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IP−−−−KSL−−−−−−−−−−−−−−−−−−−−−−−−−−PE−−−−−−−−−−−−−−−−−−−−−−−ALR−−−−−−−−−−−−LAA−−DLAEQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KQ−−−−−−−RLEQKMLMDA−−−−−−−−PK−−−−−−−−−−−−VEF−−AERVAT−−−−−−−−AS−−−−−−−−−−GVLIGNYA−−−−−−−−−−−KV−−−L−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−LGQNYLFTWLRDN−−−GIL−−−−−−IATGERRN−−−VPK−−−−−−−−−−−QEYISRGYFTLK−−−−E−−TV−−−−−−−−IDTSNGSRISFTTR−−−−ITGK−−−−−−−−GQQWLMKRLL               
fig|454168.5.peg.4637   Salmonella enterica subsp. enterica serovar Newport str. SL317                                          RKNGANIDIVTMSYKQALRVAARESKAVRR−−−−S−−−−−−−−−−−LIDK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LEAL−−−−−−−−−−−−−−−−QQA−−−−−−Q−−−−−−−−SPS−−−−−P−−−−−−−VPA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IP−−−−QSL−−−−−−−−−−−−−−−−−−−−−−−−−−PE−−−−−−−−−−−−−−−−−−−−−−−ALR−−−−−−−−−−−−LAA−−ELAEQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KQ−−−−−−−QLEEQLQTAA−−−−−−−−PK−−−−−−−−−−−−VDF−−ADRVAN−−−−−−−−AG−−−−−−−−−−GILIGNYA−−−−−−−−−−−KV−−−V−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−LGQNFLFTWLRDH−−−GIL−−−−−−CASGSRRN−−−VPK−−−−−−−−−−−QNFIEQGFFTVR−−−−E−−VV−−−−−−−−IDNDDNYRIALTTH−−−−ITGK−−−−−−−−GQQWLTRKLL               
fig|585396.4.peg.5909   Escherichia coli O111:H- str. 11128                                                                                                                                                                                                                             QKE−−−−−−Q−−−−−−−−QPI−−−−−−−−−−−−−−−A−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IP−−−−QTL−−−−−−−−−−−−−−−−−−−−−−−−−−PE−−−−−−−−−−−−−−−−−−−−−−−VLR−−−−−−−−−−−−LAA−−ELAEQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KQLLEQKAHQLNQQLVAAA−−−−−−−−PK−−−−−−−−−−−−VDF−−ADRVSV−−−−−−−−AK−−−−−−−−−−GILIGNFA−−−−−−−−−−−KV−−−V−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−LKQNALFVWLREN−−−GIL−−−−−−IASGGRKN−−−VPF−−−−−−−−−−−QQYINAGYFTVK−−−−E−−VV−−−−−−−−LDDEDGYQIRLTPQ−−−−LTGK−−−−−−−−GQQWLTRKLL               
fig|585396.4.peg.5806   Escherichia coli O111:H- str. 11128                                                                                                                                                                                                                             QKE−−−−−−Q−−−−−−−−QPV−−−−−−−−−−−−−−−A−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IP−−−−QTL−−−−−−−−−−−−−−−−−−−−−−−−−−PE−−−−−−−−−−−−−−−−−−−−−−−ALR−−−−−−−−−−−−LAA−−ELAEQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KQLLEQKAHQLNQQLVAAA−−−−−−−−PK−−−−−−−−−−−−VDF−−ADRVSV−−−−−−−−AK−−−−−−−−−−GILIGNFA−−−−−−−−−−−KV−−−V−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−LKQNALFAWLREN−−−GIL−−−−−−IASGGRKN−−−VPF−−−−−−−−−−−QQYINAGYFTVK−−−−E−−VV−−−−−−−−LDDEDGYQIRLTPQ−−−−LTGK−−−−−−−−GQQWLTRKLL               
fig|351745.7.peg.2299   Shewanella sp. W3-18-1                                                         DSIIVVAQLSPEFTA−−−−R−−−−−−−−−−−LVDR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WQEL−−−−−−−−−−−−−−−−EAK−−−−−−Q−−−−−−−−SK−−−−−P−−−−−−−YPQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IP−−−−HSF−−−−−−−−−−−−−−−−−−−−−−−−−−AE−−−−−−−−−−−−−−−−−−−−−−−ALQ−−−−−−−−−−−−LAA−−NQAKL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LE−−−−−−−Q−−−−−−−QA−−−−−−−−PK−−−−−−−−−−−−VEF−−FDRLVV−−−−−−−RDT−−−−−−−−−−LMNASQVA−−−−−−−−−−−QKHNLS−−−−−−−−−−−−−−−−−−−−A−−−−−−−−−−−−−−−−−−−−−VRLNKFLDEHDVY−−−SHA−−−−−−IKR−−GRVF−−−−−Q−−−−−−−−−−−QWFIDKGFGKLR−−−−Q−−−−−−−−−−−−−−−−−−TDQGFSQAM−−−−FTPA−−−−−−−−GEAWICEKL                
fig|323097.6.peg.3319   Nitrobacter hamburgensis X14                                                         DSYIVVAQLSPEFTA−−−−R−−−−−−−−−−−LVDR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WQEL−−−−−−−−−−−−−−−−EST−−−−−−S−−−−−−−−GR−−−−−A−−−−−−−LPQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SF−−−−−−−−−−−−−−−−−−−−−−−−−−AD−−−−−−−−−−−−−−−−−−−−−−−ALQ−−−−−−−−−−−−LAA−−DQARQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IE−−−−−−−QQHTLLIEQQ−−−−−−−−PK−−−−−−−−−−−−VEF−−YDQFVK−−−−−−−ADG−−−−−−−−−−LLGYQEAG−−−−−−−−−−−TA−−−A−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−CYPNKFCNWLKI−−−−DHL−−−−−−FYR−−GKKL−−−MPR−−−−−−−−−−−SQFVRRGLFEIR−−−−P−−−−−−−−−−−−−−−−−−ELDANGESH−−−−L−−−−−−−−−−−−RGWVTAKGVEHFAK          
fig|323097.3.peg.3085   Nitrobacter hamburgensis X14                                                         DSYIVVAQLSPEFTA−−−−R−−−−−−−−−−−LVDR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WQEL−−−−−−−−−−−−−−−−EST−−−−−−S−−−−−−−−GR−−−−−A−−−−−−−LPQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SF−−−−−−−−−−−−−−−−−−−−−−−−−−AD−−−−−−−−−−−−−−−−−−−−−−−ALQ−−−−−−−−−−−−LAA−−DQARQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IE−−−−−−−QQHTLLIEQQ−−−−−−−−PK−−−−−−−−−−−−VEF−−YDQFVK−−−−−−−ADG−−−−−−−−−−LLGYQEAG−−−−−−−−−−−TA−−−A−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−CYPNKFCNWLKI−−−−DHL−−−−−−FYR−−GKKL−−−MPR−−−−−−−−−−−SQFVRRGLFEIR−−−−P−−−−−−−−−−−−−−−−−−ELDANGESH−−−−L−−−−−−−−−−−−RGWVTAKGVEHFAK          
fig|471881.3.peg.947   Proteus penneri ATCC 35198                                                          SLVLVARLSPQFTA−−−−K−−−−−−−−−−−IVDR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WQEL−−−−−−−−−−−−−−−−ESK−−−−−−M−−−−−−−−−−Q−−−−−P−−−−−−−−−L−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IP−−−−QTL−−−−−−−−−−−−−−−−−−−−−−−−−−PE−−−−−−−−−−−−−−−−−−−−−−−ALR−−−−−−−−−−−−LAA−−DLAEE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KQ−−−−KLESE−−LAIAT−−−−−−−−PK−−−−−−−−−−−−AQF−−VDNYVL−−−−−−−STG−−−−−−−−−−SMTFRQVC−−−−−−−−−−−KL−−−L−−−−−−−−−−−−−−−−−−−−Q−−−−−−−−−−−−−−−−−−−−−VKETDFRCFLIDK−−−KIM−−−−−−YRL−−NNTF−−−TPY−−−−−−−−−−−QTHVDLGRFEIK−−−−T−−GT−−−−−−−−NQ−−TNNHAFAQSR−−−−FTAK−−−−−−−−GVKWIAGL                 
fig|525369.4.peg.3580   Proteus mirabilis ATCC 29906                                                          SLVLVARLSPQFTA−−−−K−−−−−−−−−−−IVDR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WQEL−−−−−−−−−−−−−−−−ESK−−−−−−M−−−−−−−−−−Q−−−−−P−−−−−−−−−V−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IP−−−−QTL−−−−−−−−−−−−−−−−−−−−−−−−−−PE−−−−−−−−−−−−−−−−−−−−−−−ALR−−−−−−−−−−−−LAA−−DLAEE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KQ−−−−KLESE−−LAIAT−−−−−−−−PK−−−−−−−−−−−−AQF−−VDNYVL−−−−−−−SHG−−−−−−−−−−SMTFRQVC−−−−−−−−−−−KL−−−L−−−−−−−−−−−−−−−−−−−−Q−−−−−−−−−−−−−−−−−−−−−AKETDFRCFLIDK−−−KIM−−−−−−YRL−−NNTF−−−TPY−−−−−−−−−−−QTHVDLGRFEIK−−−−T−−GT−−−−−−−−NQ−−KNNHAFAQSR−−−−FTTK−−−−−−−−GVKWIAGL                 
fig|688245.4.peg.2843   Comamonas testosteroni CNB-2                                             GQTYDEYLLDKDTSLTLLLGYDPVARM−−−−K−−−−−−−−−−−VVKR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WQEL−−−−−−−−−−−−−−−−EAQ−−−−−−−−−−−−−−−−−Q−−−−−P−−−−−−−−−A−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PA−−−−QLTR−−−−−−−−−−−−−−−−−−−−−−−−−−MD−−−−−−−−−−−−−−−−−−−−−−−ILK−−−−−−−−−−−−LA−−−−MASE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QA−−−−RIEAEAQLALAA−−−−−−−−PK−−−−−−−−−−−−VEF−−VERYVQ−−−−−−PGTG−−−−−−−−−−SMGVREVC−−−−−−−−−−−KV−−−L−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−AKLNEFTDFLLKR−−−GLM−−−−−−YRTTPKSPL−−−TPR−−−−−−−−−−−AEHMHNGRFEAK−−−−T−−GT−−−−−−−−AEHGETSHAFVHYK−−−−FTPK−−−−−−−−GVEWIAGL                 
fig|281310.6.peg.1595   Haemophilus influenzae 86-028NP                                                  EYHLTKRDSLIVVAQNCPEFTA−−−−A−−−−−−−−−−−IVDR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WQAL−−−−−−−−−−−−−−−−ENQ−−−−−−Q−−−−−−−−−−K−−−−−P−−−−−−−TAL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IP−−−−QSF−−−−−−−−−−−−−−−−−−−−−−−−−−SE−−−−−−−−−−−−−−−−−−−−−−−ALM−−−−−−−−−−−−LAA−−QLQAE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KE−−−−R−−−−−−−−−−NA−−−−−−−−PK−−−−−−−−−−−−VAF−−VDHYVE−−−−−−VGT−−−−−−−−−−−−SKSFRETA−−−−−−−−−−−KI−−−L−−−−−−−−−−−−−−−−−−−−K−−−−−−−−−−−−−−−−−−−−−MPERALVNRLVED−−−KYL−−−−−−YRQ−−SGVL−−−LPY−−−−−−−−−−−QSARTKDLFTVK−−−−T−−GT−−−−−−−−AEHG−−−−HNYTQTR−−−−VTSK−−−−−−−−GIEFIASRY                
fig|262728.1.peg.858   Haemophilus influenzae R2866                                                                 LSPEFTA−−−−A−−−−−−−−−−−VVDR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WQAL−−−−−−−−−−−−−−−−ENQ−−−−−−Q−−−−−−−−−−K−−−−−P−−−−−−−TAL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IP−−−−QSF−−−−−−−−−−−−−−−−−−−−−−−−−−SE−−−−−−−−−−−−−−−−−−−−−−−ALM−−−−−−−−−−−−LAA−−QLQAE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KE−−−−R−−−−−−−−−−NA−−−−−−−−PK−−−−−−−−−−−−VAF−−VDHYVE−−−−−−VGT−−−−−−−−−−−−SKSFRETA−−−−−−−−−−−KI−−−L−−−−−−−−−−−−−−−−−−−−K−−−−−−−−−−−−−−−−−−−−−IPERALVNRLVED−−−KYL−−−−−−YRQ−−SGVL−−−LPY−−−−−−−−−−−QSAHTKDLFTVK−−−−T−−GT−−−−−−−−AEHG−−−−HNYTQTR−−−−VTSK−−−−−−−−GIEFIASRY                
fig|374932.4.peg.75   Haemophilus influenzae PittHH                                                                 LSPEFTA−−−−A−−−−−−−−−−−VVDR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WQAL−−−−−−−−−−−−−−−−ENR−−−−−−Q−−−−−−−−−−K−−−−−P−−−−−−−TAL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IP−−−−QSF−−−−−−−−−−−−−−−−−−−−−−−−−−SE−−−−−−−−−−−−−−−−−−−−−−−ALM−−−−−−−−−−−−LAA−−QLQAE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KE−−−−R−−−−−−−−−−NA−−−−−−−−PK−−−−−−−−−−−−VAF−−VDHYVE−−−−−−IGT−−−−−−−−−−−−SKSFRETA−−−−−−−−−−−KI−−−L−−−−−−−−−−−−−−−−−−−−K−−−−−−−−−−−−−−−−−−−−−IPERALVNRLVED−−−KYL−−−−−−YRQ−−SGVL−−−LPY−−−−−−−−−−−QSAHTKDLFTVK−−−−T−−GT−−−−−−−−AEHG−−−−HNYTQTR−−−−VTSK−−−−−−−−GIEFIASRY                
fig|374928.4.peg.1901   Haemophilus influenzae PittAA                                                                 LSPEFTA−−−−A−−−−−−−−−−−VVDR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WQAL−−−−−−−−−−−−−−−−ENR−−−−−−Q−−−−−−−−−−K−−−−−P−−−−−−−TAL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IP−−−−QSF−−−−−−−−−−−−−−−−−−−−−−−−−−SE−−−−−−−−−−−−−−−−−−−−−−−ALM−−−−−−−−−−−−LAA−−QLQAE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KE−−−−R−−−−−−−−−−NA−−−−−−−−PK−−−−−−−−−−−−VAF−−VDHYVE−−−−−−VGT−−−−−−−−−−−−SKSFRETA−−−−−−−−−−−KI−−−L−−−−−−−−−−−−−−−−−−−−K−−−−−−−−−−−−−−−−−−−−−IPERALVNRLVED−−−KYL−−−−−−YRQ−−SGVL−−−LPY−−−−−−−−−−−QSAHTKDLFTVK−−−−T−−GT−−−−−−−−AEHG−−−−HNYTQTR−−−−VTSK−−−−−−−−GIEFIASRY                
fig|441620.7.peg.1905   Methylobacterium populi BJ001                                       DGEPCFVASDLARSLGYRDAVNLVRVLDEDEVTT−−−−Q−−−−−−−−−−−IVSGREIM−−−−−−−−−−−L−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VTEPGLYHAI−−−−−−−−−−−−−−−−TAR−−−−−−R−−−−−−−−QVK−−−−−S−−−−−−−LGAQVLERI−−−−−−A−−−−−RFKRWV−−−−HH−−DV−−IP−−−−−−SIR−−KTGAYS−−VRQTPAF−−−−DPEDAS−−−−−−−−−−−−−−−−−−−−−−−ALRHVLLGYTERVITLEA−−KVEEQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AQ−−−−GLAIAHEVIEQSA−−−−−−−−PK−−−−−−−−−−−−VEA−−YEHLLD−−−−−−−DSG−−−−−−−−−−ACCLADAA−−−−−−−−−−−RI−−−L−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−AEQKPFFAWLRKS−−−RIV−−−−−−FDK−−GEAL−−−LPR−−−−−−−−−−−ADLRKDGRFRVR−−−−L−−VR−−−−−−−−TRPGE−−−−HREQTL−−−−VTRQ−−−−−−−−GMIWL                    
fig|707232.3.peg.3039   Acinetobacter haemolyticus ATCC 19194                                                                                                                                                                                                                                    FLKQQVLEMNKP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SYMIE−−−D−−−−−−−−−−−−−−RVE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RAKKW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IEEET−−−−−−−−AKQQIEAKLIEAKQVIE−−VQQVDVDALERIASRKG−−−−−−−−−−SMTVRDAA−−−−−−−−−−−KLLNMRP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−I−−−DLRDWMLAN−−−−−−−−−−−−KWTYS−−−P−−−−−−−−−−−−−−−−−YK−−−−−GKYRPTAAH−−−−−−−−−−−−−−ATAGHLTLSANEYDPLVRVTWK−−−−−−−−−GLALLAKRLN              
fig|469604.7.peg.1110   Fusobacterium nucleatum subsp. vincentii 3_1_36A2                                                                                                                                                                                                                                        KCEEAWNSPEMILARA−−−−−−−−−−−−−−−−−−−−−−N−−−−−QIQSRMIENYAD−−−−−−−−−−−−−−KIR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ILENK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IEENK−−−−−−−−PKVEFYNDVIDSKNTCD−−MQTV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−A−−−−−−−−−−−KILNFKG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VGRNNLFEILREN−−−−−−−−−−−−KILQSNNQP−−−−−−−−−−−−−−−−−YQKYVDNGWFRV−−−−−−−−−−−−−−−−−−−−−−−IETKFNDYKTSEIKISFKTVVFQKGIEKISILLK                 
fig|155920.1.peg.847   Xylella fastidiosa Ann-1                                                                 LSPEFTA−−−−R−−−−−−−−−−−LVDR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WQEL−−−−−−−−−−−−−−−−ETE−−−−−−L−−−−−−−−IQ−−−−−T−−−−−−−RFV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IP−−−−QTL−−−−−−−−−−−−−−−−−−−−−−−−−−PE−−−−−−−−−−−−−−−−−−−−−−−ALR−−−−−−−−−−−−LAA−−DL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AD−−−−KNQALEKVVADQS−−−−−−−−PK−−−−−−−−−−−−VLT−−HDRIAA−−−−−−−ADG−−−−−−−−−−SLCLRDAA−−−−−−−−−−−KV−−−L−−−−−−−−−−−−−−−−−−−−Q−−−−−−−−−−−−−−−−−−−−−MRPIDLRHWLIVN−−−RWI−−−−−−YGRPGHSGW−−−LAY−−−−−−−−−−−QHRIQQGVMCHK−−−−V−−TT−−−−−−−−VQREEGTDKVIEQAR−−−−ITSK−−−−−−−−GLTTISHELTK              
fig|155920.4.peg.4086   Xylella fastidiosa subsp. sandyi Ann-1                                                                 LSPEFTA−−−−R−−−−−−−−−−−LVDR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WQEL−−−−−−−−−−−−−−−−ETE−−−−−−L−−−−−−−−IQ−−−−−T−−−−−−−RFV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IP−−−−QTL−−−−−−−−−−−−−−−−−−−−−−−−−−PE−−−−−−−−−−−−−−−−−−−−−−−ALR−−−−−−−−−−−−LAA−−DL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AD−−−−KNQALEKVVADQS−−−−−−−−PK−−−−−−−−−−−−VLT−−HDRIAA−−−−−−−ADG−−−−−−−−−−SLCLRDAA−−−−−−−−−−−KV−−−L−−−−−−−−−−−−−−−−−−−−Q−−−−−−−−−−−−−−−−−−−−−MRPIDLRHWLIVN−−−RWI−−−−−−YGRPGHSGW−−−LAY−−−−−−−−−−−QHRIQQGVMCHK−−−−V−−TT−−−−−−−−VQREEGTDKVIEQAR−−−−ITSK−−−−−−−−GLTTISHELTK              
fig|343509.12.peg.1715   Sodalis glossinidius str. 'morsitans'                                        LPQKTKIYVFIGEQGKRDSIIVVAQLCPEFTA−−−−R−−−−−−−−−−−LVDR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WQEL−−−−−−−−−−−−−−−−EKQ−−−−−−L−−−−−−−−−−−−−−−−−−−−−−−−−−A−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IPADPIQIL−−−−−−−−−−−−−−−−−−−−−−−−−−ND−−−−−−−−−−−−−−−−−−−−−−−PAA−−−−−−−−−−−−MCG−−ILLTY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TE−−−−KVIALESKVEEMA−−−−−−−−PD−−−−−−−−−−−−VKA−−LHRIAK−−−−−−−SDG−−−−−−−−−−GMCITNAA−−−−−−−−−−−KE−−−L−−−−−−−−−−−−−−−−−−−−Q−−−−−−−−−−−−−−−−−−−−−VRPKDLFAFLQER−−−GWI−−−−−−YRRVGAKNW−−−MAY−−−−−−−−−−−QSRIQSGYLEHK−−−−I−−SI−−−−−−−−IPGNDGTDKIREQVI−−−−VTPK−−−−−−−−GLAKL                    
fig|343509.6.peg.1558   Sodalis glossinidius str. 'morsitans'                                        LPQKTKIYVFIGEQGKRDSIIVVAQLCPEFTA−−−−R−−−−−−−−−−−LVDR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WQEL−−−−−−−−−−−−−−−−EKQ−−−−−−L−−−−−−−−−−−−−−−−−−−−−−−−−−A−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IPADPIQIL−−−−−−−−−−−−−−−−−−−−−−−−−−ND−−−−−−−−−−−−−−−−−−−−−−−PAA−−−−−−−−−−−−MCG−−ILLTY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TE−−−−KVIALESKVEEMA−−−−−−−−PD−−−−−−−−−−−−VKA−−LHRIAK−−−−−−−SDG−−−−−−−−−−GMCITNAA−−−−−−−−−−−KE−−−L−−−−−−−−−−−−−−−−−−−−Q−−−−−−−−−−−−−−−−−−−−−VRPKDLFAFLQER−−−GWI−−−−−−YRRVGAKNW−−−MAY−−−−−−−−−−−QSRIQSGYLEHK−−−−I−−SI−−−−−−−−IPGNDGTDKIREQVI−−−−VTPK−−−−−−−−GLAKL                    
fig|395960.4.peg.3113   Rhodopseudomonas palustris TIE-1                                                                                                                                                                                                                                                                                              FH−−DI−−LP−−−−−−TLR−−KHGRYE−−VAPPIAP−−−−VPPALP−−−−−−−−−−−−−−−−−−−−−−−DFTNPAVAARAWAEQFEGREIAET−−−−−−−−−−−−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ASALEGRVSELA−−−−−−−−PK−−−−−−−−−−−−ADA−−LDLIAS−−−−−−−ASG−−−−−−−−−−SMCITDAA−−−−−−−−−−−KA−−−LQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LRPKSLFTFLRQR−−−DWIY−−−−RRDGA−−−E−−−LGY−−−−−−−−−−−QDKVAAGYLEHKTTII−−DR−−−−−−−−DGVKET−−−−RIQVR−−−−VTPK−−−−−−−−GLTALARKF                
fig|320372.3.peg.4412   Burkholderia pseudomallei 1710b                                                                NGDPWFVA−−−−K−−−−−−−DVCDVLGITNPS−−−−−−DALTAL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DDDEK−−−−−−ASFNLGLRGSA−−−−−−−−−−−−−−−−−−−−−−PRV−−−−−−−VSESGLYALI−−−−−−−−−−−−−−−−MRS−−−−−−R−−−−−−−−KPQ−−−−−A−−−−−−−−−−−−−−−−−−−−−−R−−−−−AFRKWV−−−−TS−−VV−−LP−−−−−−AIR−−KDGSY−−−VMGEEK−−−−−−−−−−V−−−−−−−−−−−−−−−−−−−−−−−−ATGEMDEAELMARAMIAANNK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IERLQTQIAANA−−−−−−−−PK−−−−−−−−−−−−VDF−−YETHTA−−−−−−−PRG−−−−−−−−−−NMGFREFA−−−−−−−−−−−KT−−−LG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VYERDLRAFLSPEYLVKLRA−−−−DGGSVRV−−−APK−−−−−−−−−−−YRSF−−GWFATV−−−−−−−−P−−−−−−−−−−−−−−−−−−GKVV−−−−−ITPA−−−−−−−−GRRALAERF                
fig|439496.3.peg.97   Rhodobacterales bacterium Y4I                                                                DGSPWFVA−−−−K−−−−−−−DVCDALGIGNPS−−−−−−MAVASL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EEDEV−−−−−−TLSTIE−−GSH−−−−−−−−−−−−−−−−−−−−RPTNL−−−−−−−ISESGLYALI−−−−−−−−−−−−−−−−FQS−−−−−−R−−−−−−−−KAE−−−−−A−−−−−−−−−−−−−−−−−−−−−−K−−−−−AFRKWV−−−−TS−−TV−−LP−−−−−−AIR−−KTGSY−−−VSGEEH−−−−−−−−−−L−−−−−−−−−−−−−−−−−−−−−−−DPTAPDYLDRLKDLMIEAQERK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IAAQAAELKKAQ−−−−−−−−PL−−−−−−−−−−−−AAA−−FERNMM−−−−−−−MTG−−−−−−−−−−GMGIQEYA−−−−−−−−−−−RS−−−KGLGPNK−−−−−−−−−−−−−−F−−−−−−−−−−−−−−−−−−−−−AKWLQVEGFISKK−−−E−−−−−−−−RGAKTIY−−−TPY−−−−−−−−−−−ARKNKGGLFETVKHQ−−−−H−−−−−−−−−−−−−−−−−−GQLVR−−−−ITAK−−−−−−−−GVLFFDRL                 
fig|272942.6.peg.2625   Rhodobacter capsulatus SB1003                                                                DGEPWFIA−−−−R−−−−−−−DVCDVLGLDNVT−−−−−−KALLSL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DPDEK−−−−−−ALNNVQSLGGA−−−−−−−−−−−−−−−−−−−−QTTNI−−−−−−−ISESGLYALV−−−−−−−−−−−−−−−−LRS−−−−−−R−−−−−−−−RPE−−−−−A−−−−−−−−−−−−−−−−−−−−−−K−−−−−AFRKWV−−−−TA−−TV−−LP−−−−−−TIR−−KTGSY−−−VRGEEA−−−−−−−−−−F−−−−−−−−−−−−−−−−−−−−−−−DVTTEAGLAAATMHVMAALQAK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ADGFKAMYEAAK−−−−−−−−PK−−−−−−−−−−−−ADA−−FAVIAE−−−−−−−ATG−−−−−−−−−−SMTVTEAA−−−−−−−−−−−KA−−−LK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AKRVDLYGFLEHR−−−KWVT−−−−KGKGRQA−−−TAY−−−−−−−−−−−ALRT−−GYMDTRTHTD−−PR−−−−−−−−−−−−−−−−−−GRVRTTPVVTPK−−−−−−−−GFAYLAQ                  
fig|391037.6.peg.3770   Salinispora arenicola CNS-205                                                                 NEPWFVA−−−−V−−−−−−−DVCRALEIGNPR−−−−−−QAVSYL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DDDEV−−−−−−RQAPVTTDDGSDRV−−−−−−−−−−−−−−−−−LMTNV−−−−−−−VSEAGLYSLI−−−−−−−−−−−−−−−−LRS−−−−−−R−−−−−−−−KPE−−−−−A−−−−−−−−−−−−−−−−−−−−−−K−−−−−AFKRWV−−−−TH−−DV−−LP−−−−−−AIR−−ATGRY−−−−ESVPA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−PQSYADALQ−−−LAADQAR−−−−−−−−−−−−−−−Q−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LDAQAAELAEAA−−−−−−−−PK−−−−−−−−−−−−AAS−−WDTLAS−−−−−−−AEG−−−−−−−−−−DWSVRDAA−−−−−−−−−−−KV−−−LSRDPGL−−−−−−−−−−−−−−D−−−−−−−−−−−−−−−−−−−−−LGERRLFTVLGEQ−−−QWIY−−−−RQRADGRW−−−RPY−−−−−−−−−−−QRAIESGWLSELPSTH−−YH−−−−−−−−PRTGELVLDTPQVR−−−−VTTR−−−−−−−−GLHLLHRRL                
fig|391037.6.peg.3821   Salinispora arenicola CNS-205                                                                 NEPWFVA−−−−V−−−−−−−DVCRALEIGNPR−−−−−−QAVSYL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DDDEV−−−−−−RQAPVTTDDGSDRV−−−−−−−−−−−−−−−−−LMTNV−−−−−−−VSEAGLYSLI−−−−−−−−−−−−−−−−LRS−−−−−−R−−−−−−−−KPE−−−−−A−−−−−−−−−−−−−−−−−−−−−−K−−−−−AFKRWV−−−−TH−−DV−−LP−−−−−−AIR−−ATGRY−−−−ESVPA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−PQSYADALQ−−−LAADQAR−−−−−−−−−−−−−−−Q−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LDAQAAELAEAA−−−−−−−−PK−−−−−−−−−−−−AAS−−WDTLAS−−−−−−−AEG−−−−−−−−−−DWSVRDAA−−−−−−−−−−−KV−−−LSRDPGL−−−−−−−−−−−−−−D−−−−−−−−−−−−−−−−−−−−−LGERRLFTVLGEQ−−−QWIY−−−−RQRADGRW−−−RPY−−−−−−−−−−−QRAIESGWLSELPSTH−−YH−−−−−−−−PRTGELVLDTPQVR−−−−VTTR−−−−−−−−GLHLLHRRL                
fig|391037.3.peg.3597   Salinispora arenicola CNS-205                                                                 NEPWFVA−−−−V−−−−−−−DVCRALEIGNPR−−−−−−QAVSYL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DDDEV−−−−−−RQAPVTTDDGSDRV−−−−−−−−−−−−−−−−−LMTNV−−−−−−−VSEAGLYSLI−−−−−−−−−−−−−−−−LRS−−−−−−R−−−−−−−−KPE−−−−−A−−−−−−−−−−−−−−−−−−−−−−K−−−−−AFKRWV−−−−TH−−DV−−LP−−−−−−AIR−−ATGRY−−−−ESVPA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−PQSYADALQ−−−LAADQAR−−−−−−−−−−−−−−−Q−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LDAQAAELAEAA−−−−−−−−PK−−−−−−−−−−−−AAS−−WDTLAS−−−−−−−AEG−−−−−−−−−−DWSVRDAA−−−−−−−−−−−KV−−−LSRDPGL−−−−−−−−−−−−−−D−−−−−−−−−−−−−−−−−−−−−LGERRLFTVLGEQ−−−QWIY−−−−RQRADGRW−−−RPY−−−−−−−−−−−QRAIESGWLSELPSTH−−YH−−−−−−−−PRTGELVLDTPQVR−−−−VTTR−−−−−−−−GLHLLHRRL                
fig|391037.3.peg.3648   Salinispora arenicola CNS-205                                                                 NEPWFVA−−−−V−−−−−−−DVCRALEIGNPR−−−−−−QAVSYL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DDDEV−−−−−−RQAPVTTDDGSDRV−−−−−−−−−−−−−−−−−LMTNV−−−−−−−VSEAGLYSLI−−−−−−−−−−−−−−−−LRS−−−−−−R−−−−−−−−KPE−−−−−A−−−−−−−−−−−−−−−−−−−−−−K−−−−−AFKRWV−−−−TH−−DV−−LP−−−−−−AIR−−ATGRY−−−−ESVPA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−PQSYADALQ−−−LAADQAR−−−−−−−−−−−−−−−Q−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LDAQAAELAEAA−−−−−−−−PK−−−−−−−−−−−−AAS−−WDTLAS−−−−−−−AEG−−−−−−−−−−DWSVRDAA−−−−−−−−−−−KV−−−LSRDPGL−−−−−−−−−−−−−−D−−−−−−−−−−−−−−−−−−−−−LGERRLFTVLGEQ−−−QWIY−−−−RQRADGRW−−−RPY−−−−−−−−−−−QRAIESGWLSELPSTH−−YH−−−−−−−−PRTGELVLDTPQVR−−−−VTTR−−−−−−−−GLHLLHRRL                
fig|369723.5.peg.4150   Salinispora tropica CNB-440                                                                             A−−−−−−−DACQGLDLTNPS−−−−−−MAASRL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−HADDL−−−−−−STAEVI−−DGMGRR−−−−−−−−−−−−−−−−−QHVRI−−−−−−−TNESGLYDLI−−−−−−−−−−−−−−−−FQS−−−−−−R−−−−−−−−KPE−−−−−A−−−−−−−−−−−−−−−−−−−−−−R−−−−−AFRRWV−−−−TH−−EV−−LP−−−−−−AIR−−ATGRY−−−−ESVPA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−PQSYADALQ−−−LAADQAR−−−−−−−−−−−−−−−Q−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LDAQAAELAEAA−−−−−−−−PK−−−−−−−−−−−−AQS−−WDTLAS−−−−−−−ADG−−−−−−−−−−DWSVRDAA−−−−−−−−−−−KI−−−LSRDPNL−−−−−−−−−−−−−−N−−−−−−−−−−−−−−−−−−−−−VGERRLFTVLGEQ−−−QWIY−−−−RQRGDGRW−−−RPY−−−−−−−−−−−QRAVESGWLSELPASH−−YH−−−−−−−−PRTGELVLDVPQVR−−−−VTTR−−−−−−−−GLHLLHRRL                
fig|369723.3.peg.3958   Salinispora tropica CNB-440                                                                 GEPWFVV−−−−A−−−−−−−DACQGLDLTNPS−−−−−−MAASRL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−HADDL−−−−−−STAEVI−−DGMGRR−−−−−−−−−−−−−−−−−QHVRI−−−−−−−TNESGLYDLI−−−−−−−−−−−−−−−−FQS−−−−−−R−−−−−−−−KPE−−−−−A−−−−−−−−−−−−−−−−−−−−−−R−−−−−AFRRWV−−−−TH−−EV−−LP−−−−−−AIR−−ATGRY−−−−ESVPA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−PQSYADALQ−−−LAADQAR−−−−−−−−−−−−−−−Q−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LDAQAAELAEAA−−−−−−−−PK−−−−−−−−−−−−AQS−−WDTLAS−−−−−−−ADG−−−−−−−−−−DWSVRDAA−−−−−−−−−−−KI−−−LSRDPNL−−−−−−−−−−−−−−N−−−−−−−−−−−−−−−−−−−−−VGERRLFTVLGEQ−−−QWIY−−−−RQRGDGRW−−−RPY−−−−−−−−−−−QRAVESGWLSELPASH−−YH−−−−−−−−PRTGELVLDVPQVR−−−−VTTR−−−−−−−−GLHLLHRRL                
fig|281090.3.peg.1917   Leifsonia xyli subsp. xyli str. CTCB07                                                                DGEPWFIL−−−−R−−−−−−−DVLSVLGLSNPT−−−−−−EAVRSL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DEDEF−−−−−−STTELSLDGQ−−R−−−−−−−−−−−−−−−−−RNYYL−−−−−−−VNEPGLYSLI−−−−−−−−−−−−−−−−LRS−−−−−−R−−−−−−−−KTE−−−−−A−−−−−−−−−−−−−−−−−−−−−−R−−−−−AFKRWV−−−−TH−−EV−−LP−−−−−−QIR−−RTGSY−−−−SVVPA−−−−−−−−−−D−−−−−−−−−−−−−−−−−−−−−−−DVALPQNYVEALEALLVREKANQ−−−−−−−−−−−−−−−Q−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LIVENAGLV−−−−−−−−−−−PR−−−−−−−−−−−−AGA−−WDAIAS−−−−−−−AVG−−−−−−−−−−DYSVGDAA−−−−−−−−−−−KI−−−LSRAGI−−−−−−−−−−−−−−P−−−−−−−−−−−−−−−−−−−−−TGPQRLFAQLEGI−−−RWVY−−−−RGGDGKW−−−RAY−−−−−−−−−−−AERVEKGYLAEKAQFH−−HH−−−−−−−−PATGDLVLDAPQVR−−−−GTVK−−−−−−−−GVDRLRQRL                
fig|446471.4.peg.1284   Xylanimonas cellulosilytica DSM 15894                                                                 GDPWFVA−−−−A−−−−−−−DVAAALSLGNIH−−−−−−SSLSLL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DDDEK−−−−−−GLHTVETLGGA−−−−−−−−−−−−−−−−−−−−QTTST−−−−−−−VNEPGLYSLV−−−−−−−−−−−−−−−−LRS−−−−−−R−−−−−−−−KPE−−−−−A−−−−−−−−−−−−−−−−−−−−−−K−−−−−AFKRWV−−−−TH−−DV−−LP−−−−−−AIR−−KTGSY−−−−−GVPA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LTGPELMARAL−−−−IEADAT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IKAAHAELAVAR−−−−−−−−PK−−−−−−−−−−−−VEA−−FDAFLS−−−−−−−TDG−−−−−−−−−−DYSVRDAA−−−−−−−−−−−HV−−−LSRHHAI−−−−−−−−−−−−−−L−−−−−−−−−−−−−−−−−−−−−TGEKRLRDWMLTA−−−GWLY−−−−RDPTGAP−−−RAY−−−−−−−−−−−QRRIDAGHLVEKAQWH−−YR−−−−−−−−PDNGEKVTDPPQVR−−−−VTPR−−−−−−−−GIEALAKALT               
fig|243243.7.peg.814   Mycobacterium avium 104                                                                  EPWFVA−−−−A−−−−−−−DACRMLSLRDTT−−−−−−SAMKMV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−HDDDKRLLHRSDTPQLFEGIAAQV−−−−−−−−−−−−−−−−−QVITV−−−−−−−VNESGMYALI−−−−−−−−−−−−−−−−FQS−−−−−−N−−−−−−−−KDR−−−−−A−−−−−−−−−−−−−−−−−−−−−−R−−−−−DVRRWV−−−−TS−−EV−−LP−−−−−−SIR−−KTGSY−−−−−−−GA−−−−−−−−−−P−−−−−−−−−−−−−−−−−−−−−−−VLTEDEIVHRALTITQAR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VEALTAKVVELA−−−−−−−−AP−−−−−−−−−−−−ASA−−WNELAE−−−−−−−STG−−−−−−−−−−DYSVADAA−−−−−−−−−−−KV−−−LSRDPSI−−−−−−−−−−−−−−S−−−−−−−−−−−−−−−−−−−−−IGRDRLFLFMSAE−−−RWLF−−−−KRDGR−−−W−−−RAY−−−−−−−−−−−QAQVDCGRLAEKVGRP−−FW−−−−−−−−HEGRGELVAGEPTVR−−−−ITPK−−−−−−−−GLAELHKRLR               
fig|243243.7.peg.813   Mycobacterium avium 104                                                                DGDPWFVL−−−−A−−−−−−−DLCRVLDIRNAR−−−−−−DVAARL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ADDQKGVDQVDTP−−−−−−−GGR−−−−−−−−−−−−−−−−−QQMTL−−−−−−−VSEAGMYEVV−−−−−−−−−−−−−−−−IRS−−−−−−D−−−−−−−−KSE−−−−−A−−−−−−−−−−−−−−−−−−−−−−V−−−−−SFRRWV−−−−TG−−EV−−LP−−−−−−AIR−−KTGTYS−−RYPAGP−−−−−−−−−−A−−−−−−−−−−−−−−−−−−−−−−−ALPSKKELAQWVIDAEER−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AERAEAKVAELT−−−−−−−−PP−−−−−−−−−−−−AAA−−WNELAE−−−−−−−SAG−−−−−−−−−−DYSVADAA−−−−−−−−−−−KV−−−LSRDPQI−−−−−−−−−−−−−−E−−−−−−−−−−−−−−−−−−−−−TGERRLYAFMAAI−−−GWVF−−−−KVKGR−−−W−−−RAY−−−−−−−−−−−QSQVEIGRLSEKVGKP−−FW−−−−−−−−HEGRGEMVLPDPTVR−−−−ITPK−−−−−−−−GVAELHKRL                
fig|196164.6.peg.846   Corynebacterium efficiens YS-314                                                                                                                                                                                                                                                                                              TR−−EV−−LP−−−−−−SIR−−RHGGYL−−TDPKIE−−−−−−−−−−E−−−−−−−−−−−−−−−−−−−−−−−ILTDPDTIIKLATDLKQER−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ARRL−−−−−ELE−−−−−−−−QP−−−−−−−−−−−−ARS−−WEQLAD−−−−−−−AAG−−−−−−−−−−DYSVATAA−−−−−−−−−−−KV−−−LSRDPSI−−−−−−−−−−−−−−K−−−−−−−−−−−−−−−−−−−−−IGRDRLFAEMASA−−−GWVF−−−−RSKARRGPW−−−EAS−−−−−−−−−−−QKKAVDTGRLVHKLGRP−−FF−−−−−−−−NERTEEWEQPAPTIR−−−−VTPK−−−−−−−−GLLDLHRLL                
fig|196164.1.peg.828   Corynebacterium efficiens YS-314                                                                 GEPQWVA−−−−A−−−−−−−DIAAVLGLGRTH−−−−−−DMVRSL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DEDERGAVTIRTP−−−−−−−SGE−−−−−−−−−−−−−−−−−QEMTV−−−−−−−ITESGLYSCI−−−−−−−−−−−−−−−−LRS−−−−−−R−−−−−−−−KPE−−−−−A−−−−−−−−−−−−−−−−−−−−−−K−−−−−EFKRWV−−−−TR−−EV−−LP−−−−−−SIR−−RHGGYL−−TDPKIE−−−−−−−−−−E−−−−−−−−−−−−−−−−−−−−−−−ILTDPDTIIKLATDLKQER−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ARRL−−−−−ELE−−−−−−−−QP−−−−−−−−−−−−ARS−−WEQLAD−−−−−−−AAG−−−−−−−−−−DYSVATAA−−−−−−−−−−−KV−−−LSRDPSI−−−−−−−−−−−−−−K−−−−−−−−−−−−−−−−−−−−−IGRDRLFAEMASA−−−GWVF−−−−RSKARRGPW−−−EAS−−−−−−−−−−−QKKAVDTGRLVHKLGRP−−FF−−−−−−−−NERTEEWEQPAPTIR−−−−VTPK−−−−−−−−GLLDLHRLL                
fig|596312.3.peg.1641   Micrococcus luteus SK58                                                                DGEPHFVA−−−−A−−−−−−−DLCAVLEIGRQQ−−−−−−DATRYL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DADEK−−−−−−RGCLVDTPSGP−−−−−−−−−−−−−−−−−−−−QTMVV−−−−−−−VTEAGMYSLV−−−−−−−−−−−−−−−−LRS−−−−−−R−−−−−−−−KPE−−−−−A−−−−−−−−−−−−−−−−−−−−−−K−−−−−AFKRWL−−−−TH−−EV−−LP−−−−−−AIR−−KTGAY−−−−SVQRE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LTEDEIIHRALTLTVAK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VEALEAKVAEDA−−−−−−−−PK−−−−−−−−−−−−VAA−−WESIVS−−−−−−−SAG−−−−−−−−−−SWSYNDAA−−−−−−−−−−−KV−−−LCESGQI−−−−−−−−−−−−−−E−−−−−−−−−−−−−−−−−−−−−IGEKRLVKALVDW−−−GYLY−−−−RDAKGRP−−−HVY−−−−−−−−−−−QRYVEQGLFVVKARTY−−RD−−−−−−−−LVSGEVRESAAPQVR−−−−LTGK−−−−−−−−G                        
fig|525368.3.peg.2091   Mycobacterium parascrofulaceum ATCC BAA-614                                                                DERRWAVA−−−−A−−−−−−−DICAAIDIRDVSAAIAKLDQR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKMVIRRSDTPGSNQGIWQQISPRV−−−−−−−−−−−−−−−−−QSIGL−−−−−−−VSEDGATDLV−−−−−−−−−−−−−−−−LES−−−−−−R−−−−−−−−KPE−−−−−A−−−−−−−−−−−−−−−−−−−−−−R−−−−−RFRRFL−−−−TH−−EV−−WP−−−−−−AIR−−DTGSYSTVPTL−−TD−−−−DELIHR−−−−−−−−−−−−−−−−−−−−−−−ALEVSAR−−−−−−−−−−RVAELTER−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VAELE−−−−−−−−PQ−−−−−−−−−−−−AAV−−ATKLLD−−−−−−−AEG−−−−−−−−−−DLSVRDAATSLTRAGI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KIGAGRLFAELERR−−−GWI−−−−−−KRALGDGRY−−−RVM−−−−−−−−−−−QKAIETGYMSVL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PQSHYHPKTGVLVLDPPQPRVTPKG
fig|216594.6.peg.4227   Mycobacterium marinum M                                                                DGRRWAVA−−−−A−−−−−−−DICGFLELSNPSMALKRIDDA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKRILHRSEALNSIEGFWESFAAKV−−−−−−−−−−−−−−−−−HSVGL−−−−−−−VSEDGATDLV−−−−−−−−−−−−−−−−LDS−−−−−−R−−−−−−−−KPD−−−−−A−−−−−−−−−−−−−−−−−−−−−−R−−−−−RFRRFL−−−−TH−−TV−−WP−−−−−−SIR−−DTGSYTTAPALPQTR−−−−EERLAL−−−−−−−−−−−−−−−−−−−−−−−AVIDAQQ−−−−−−−−−−MITEKDEQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LAALT−−−−−−−−GE−−−−−−−−−−−−KKC−−LEAAIE−−−−−−−RDA−−−−−−−−−−PLVAKAEAHTGSDSAIHRQAF−−−AREVQHWGQKQGV−−−−−−−−DIKHSEVMRFLSHIGLFIRGDRTDTGHATADAQRR−−−GL−−−−−−−−−AFTDKGT−−−AKN−−−−−−−−−−−GHAWATGKLTAA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GQDY                     
fig|521095.6.peg.541   Atopobium parvulum DSM 20469                                                                DGEPWFIA−−−−Q−−−−−−−DVCRALGTDVKD−−−−−−−−−−−−−−−−−−−−−−−−−−−−VRSVLECDEVSNLDTIEVYKKPGRSPLI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VSEAGLYNLV−−−−−−−−−−−−−−−−LRS−−−−−−R−−−−−−−−KPE−−−−−A−−−−−−−−−−−−−−−−−−−−−−K−−−−−PFRRWV−−−−TH−−EV−−LP−−−−−−SIR−−RSGGYIATDGSESNE−−−−DLLARA−−−−−−−−−−−−−−−−−−−−−−−VLVANEAIQRKDA−−−−−−−QLKEQ−−−−−−−−−−−−−−−QRQLYEKDTT−−−−−−−−−−−−−−−−−−−−−−−−IIEQGAKIDELA−−−−−−−−PK−−−−−−−−−−−−AGM−−YDTVIN−−−−−−−VKG−−−−−−−−−−TMTITDAA−−−−−−−−−−−RY−−−LSQYDPQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ITRKRLFALLRAD−−−GLI−−−−−−CRVGK−−−−−−−APT−−−−−−−−−−−KKGIETGRFVQI−−−−−−−−−−−−−−−−−−−−−MSTRRDGKSNEPYARMTQK−−−−−−−−G                        
fig|445972.6.peg.840   Anaerotruncus colihominis DSM 17241                                                                                     TTCQTVEMKF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−INEGNLYRLI−−−−−−−−−−−−−−−−VHS−−−−−−K−−−−−−−−LPA−−−−−A−−−−−−−−−−−−−−−−−−−−−−E−−−−−RFEKWV−−−−FD−−EV−−LP−−−−−−AIR−−KTGGY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GRVDVTAIIMQTATAVCA−−EMVKQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LAPLFQGMTRAPVPP−−−−−−−−−−−−ASE−−−−−−−−−−−−−−−−−−E−−−−−−−−−−YMVLDDMP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VKRPKLRK−−−−−−−−−−−−−−−−−KPASIIDRL−−−CPE−−−−−−−−−−−LRREVEKMLCDGRHTYSEICAW−−−−−−−−LRQEGISISTASVCR−−−−YAKRTGCYAAY                          
fig|155920.1.peg.1887   Xylella fastidiosa Ann-1                                                                DGVPHLSA−−−−R−−−−−−−DLAHALGYADERSVLRIYN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RHSEEFTYQMTLVVNLTTVTG−−−−−−DKPTRL−−−−−−−FNPRGCHMVS−−−−−−−−−−−−−−−−MFA−−−−−−R−−−−−−−−TSV−−−−−A−−−−−−−−−−−−−−−−−−−−−−A−−−−−AFRRWV−−−−LDVLEF−−MP−−−−−−SIR−−KTGGYS−−−−−−−ASHPPAVTLTEEEAFNLYALLRMVAGHLSR−−ERIEPIE−−−−−−−QALRLMHSPLTGA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VSDLWR−−−−−−−−−−−−−−−−−−−−−−−EVGPRA−−−−−−−−−−−K−−−RMEDIAER                                                                                                                                                                             
fig|155920.4.peg.3534   Xylella fastidiosa subsp. sandyi Ann-1                                                                DGVPHLSA−−−−R−−−−−−−DLAHALGYADERSVLRIYN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RHSEEFTYQMTLVVNLTTVTG−−−−−−DKPTRL−−−−−−−FNPRGCHMVS−−−−−−−−−−−−−−−−MFA−−−−−−R−−−−−−−−TSV−−−−−A−−−−−−−−−−−−−−−−−−−−−−A−−−−−AFRRWV−−−−LDVLEF−−MP−−−−−−SIR−−KTGGYS−−−−−−−ASHPPAVTLTEEEAFNLYALLRMVAGHLSR−−ERIEPIE−−−−−−−QALRLMHSPLTGA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VSDLWR−−−−−−−−−−−−−−−−−−−−−−−EVGPRA−−−−−−−−−−−K−−−RMEDIAER                                                                                                                                                                             
fig|155920.1.peg.1953   Xylella fastidiosa Ann-1                                                                DGVPHLSA−−−−R−−−−−−−DLAHALGYADERSVLRIYN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RHSEEFTYQMTLVVNLTTVTG−−−−−−DKPTRL−−−−−−−FNPRGCHMVS−−−−−−−−−−−−−−−−MFA−−−−−−R−−−−−−−−TSV−−−−−A−−−−−−−−−−−−−−−−−−−−−−A−−−−−AFRRWV−−−−LDVLEF−−MP−−−−−−SIR−−KTGSYS−−−−−−−ASHPPAVTLTEEEAFNLYALLRMVAGHLSR−−ERIEPIE−−−−−−−QALHLIRSPLAGA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VSDLWR−−−−−−−−−−−−−−−−−−−−−−−EVGPRA−−−−−−−−−−−K−−−RMENLA                                                                                                                                                                               
fig|155920.4.peg.5509   Xylella fastidiosa subsp. sandyi Ann-1                                                                DGVPHLSA−−−−R−−−−−−−DLAHALGYADERSVLRIYN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RHSEEFTYQMTLVVNLTTVTG−−−−−−DKPTRL−−−−−−−FNPRGCHMVS−−−−−−−−−−−−−−−−MFA−−−−−−R−−−−−−−−TSV−−−−−A−−−−−−−−−−−−−−−−−−−−−−A−−−−−AFRRWV−−−−LDVLEF−−MP−−−−−−SIR−−KTGSYS−−−−−−−ASHPPAVTLTEEEAFNLYALLRMVAGHLSR−−ERIEPIE−−−−−−−QALHLIRSPLAGA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VSDLWR−−−−−−−−−−−−−−−−−−−−−−−EVGPRA−−−−−−−−−−−K−−−RMENLA                                                                                                                                                                               
fig|155920.4.peg.3928   Xylella fastidiosa subsp. sandyi Ann-1                                                                DGVPHLTA−−−−A−−−−−−−DLARALGYADERSVSRIYN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RHSEEFTYQMTLVVNLTVKGFGSGNSDKPVRL−−−−−−−FSPRGCHMVA−−−−−−−−−−−−−−−−MFA−−−−−−R−−−−−−−−TSV−−−−−A−−−−−−−−−−−−−−−−−−−−−−A−−−−−AFRRWV−−−−LDVLEF−−MP−−−−−−SIR−−KTGGYS−−−−−−−ASHPPAVTLTEVEAFRLYALLRMVAGHLSR−−ERIEPIE−−−−−−−QALHLIRSPLAGA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VSDLWR−−−−−−−−−−−−−−−−−−−−−−−EVGPRA−−−−−−−−−−−K−−−RMENLA                                                                                                                                                                               
fig|183190.5.peg.1423   Xylella fastidiosa Temecula1                                                                DGNPWFVA−−−−T−−−−−−−DVAVALGYRDAANAARHVG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AHQ−−−−−KGTHIVS−−TIKG−−−−−−NQSLTI−−−−−−−VSEGGLYRLV−−−−−−−−−−−−−−−−LRS−−−−−−R−−−−−−−−RAE−−−−−A−−−−−−−−−−−−−−−−−−−−−−V−−−−−AFSDWV−−−−TD−−EV−−LP−−−−−−SIR−−KTGSYS−−−−−−−ASHPPVVTLTEEEAFNLYALLRMVAGHLSR−−ERIEPIE−−−−−−−QALHLIRSPLAGA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VSDLWR−−−−−−−−−−−−−−−−−−−−−−−EVGPRA−−−−−−−−−−−K−−−RMENLA                                                                                                                                                                               
fig|218491.3.peg.1893   Erwinia carotovora subsp. atroseptica SCRI1043                                                             DHE−−−−LLFKA−−−−T−−−−−−−QVAGAAGIKYPSASVNKIVDFKGFNGVALRVSDLGETSHKMLGHRVSPKMWL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FNEAAVYSML−−−−−−−−−−−−−−−−LRG−−−−−−H−−−−−−−−TTA−−−−−G−−−−−−−−−−−−−−−−−−−−−−E−−−−−PFRKWV−−−−TE−−EV−−LP−−−−−−TIR−−KTGSYNVETSETPEGIQFAAEFSA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MRLMLNDLRDE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VAGLKETILKWKIPA−−−−−−−−−−−−−−−−−PMQV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IA−−−−−−−−−−−K−−−−−−−−SPY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EGQAKSNVFHAMS−−−AKQYNEC−−−−AEGLNVS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RLVSELGVTP−−−−−−−−SHL                                                     
fig|243159.3.peg.1014   Acidithiobacillus ferrooxidans ATCC 23270                                                         MRKLDEDEKTTLCLTP−−−−G−−−−−−−HVKQGLSDNAPGTSLN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−L−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VNEPGLYRLI−−−−−−−−−−−−−−−−LTS−−−−−−R−−−−−−−−KPE−−−−−A−−−−−−−−−−−−−−−−−−−−−−H−−−−−AFKRWV−−−−TH−−EV−−LP−−−−−−MIR−−KTGKYETSPAQPKYARFADVDWPA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VARMH−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AAYKRVAKSRKIPV−−−−−−−−−−−−−−−−−AAQVTV−−−−−−−ADLAVELLIGVPLRAIISDAIA−−−−−−−−−−−QLGDLTEPTTDV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RTKAGPSEHVAID−−−SIQETDVRLSPEATLNVS−−−DLG−−−−−−−−−−−ALLGGYTGIAFNRLLYGLGYQV−−−−−−−−RHTIRGKSEWHPTEK−−−−−−−−−−−−−−−−GTPFAVKIFVPRTGGRGADVPQLLW
fig|497965.5.peg.4122   Cyanothece sp. PCC 7822                                                                DGEPWFVA−−−−K−−−−−−−DVCNVLEHSDVSMACQRLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SYE−−−−−KGTSIVC−−TPGG−−−−−−NQEMAI−−−−−−−ISESGLYRLV−−−−−−−−−−−−−−−−LTS−−−−−−R−−−−−−−−KPQ−−−−−A−−−−−−−−−−−−−−−−−−−−−−E−−−−−PFQDWV−−−−CQ−−EV−−LP−−−−−−SIR−−QTGRYE−−−−−−−VQPPQPKAQGE−−−−−−−−LILMLAQEAVERDKRINALEAEHNETRHEMAMIKSQLADT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TGRLDR−−−−−−−−−−−−−−−−−−−−−−−QA                                                                                                                                                                                                        
fig|485916.5.peg.1886   Desulfotomaculum acetoxidans DSM 771                                                                NGEPWFAA−−−−K−−−−−−−DVCDILEISNSRHATSRLP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ERM−−−−−KDTVVLS−−DAVG−−−−−RTKEMTI−−−−−−−ISEPGLYKLV−−−−−−−−−−−−−−−−VRS−−−−−−D−−−−−−−−KPE−−−−−A−−−−−−−−−−−−−−−−−−−−−−E−−−−−KFTDWV−−−−VE−−EV−−LP−−−−−−SIR−−KTGTYS−−−−−−−NRH−−−−−−TEID−−−−−−LLLASAEWQVRAAREIISIK−−−−−−−QQLKITEERLDDT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−