(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00011901

fig|279808.3.peg.2059   Staphylococcus haemolyticus JCSC1435           EKYYLYRPDGTEEIKVEKRKPNVNTVKTLTGAHFSEETKEMTDSNLKHFKATYGLLYEEELGLQSTIFDI
fig|979222.3.peg.1553   Staphylococcus epidermidis NIH04008          IEKYYLYRPDGTEEIKVEKRESNLNIVKSLTGAHFSEESKKMTDSELKRFKGVYELLYEEELGLQATIFDM
fig|585161.3.peg.1826   Staphylococcus aureus subsp. aureus WW2703/97     MLKMPKEKYYLYREDGTEDIKIIKYEDNENEVYSLTGAHFSDEKKIMTDSDLKHFKGAHGLLYEQELGLQVTIFDI
fig|585147.3.peg.1523   Staphylococcus aureus subsp. aureus A017934/97        MPKEKYYLYREDGTEDIKIIKYEDNENEVYSLTGAHFSDEKKIMTDSDLKHFKGAHGLLYEQELGLQVTIFDI
fig|585155.3.peg.2443   Staphylococcus aureus subsp. aureus H19        MPKEKYYLYREDGTEDIKVIKYEDNENEVYSLTGAHFSDEKKIMTDSDLKHFKGAHGLLYEQELGLQATIFDI
fig|553596.3.peg.91   Staphylococcus aureus A9781     MLKMPKEKYYLYREDGTEDIKVIKHEDNENEVYSLTGAHFSDEKKIMTDSDLKRFKGAHGLLYEQELGLQATIFDI
fig|1213734.3.peg.1771   Staphylococcus aureus M0927        MPKEKYYLYREDGTEDIKVIKHEDNENEVYSLTGAHFSDEKKIMTDSDLKRFKGAHGLLYEQELGLQATIFDI
fig|1213734.3.peg.768   Staphylococcus aureus M0927        MPKEKYYLYREDGTEDIKVIKHEDNENEVYSLTGAHFSDEKKIMTDSDLKRFKGAHGLLYEQELGLQATIFDI
fig|585149.6.peg.1635   Staphylococcus aureus subsp. aureus C101        MPKEKYYLYREDGAEDIKVIKHEDNENEVYSLTGAHFSDEKKIMTDSDLKRFKGAHGLLYEQELGLQATIFDI
fig|553583.3.peg.1967   Staphylococcus aureus A9635        MPKEKYYLYREDGTEDIKVIKYKENENEVYSLTGAHFSDEKKIMTDSDLKRFKGAHGLLYEQELGLQVTIFDI
fig|585152.3.peg.1956   Staphylococcus aureus subsp. aureus D139     MLKMPKEKYYLYREDGTEDIKVIKYKENENEVYSLTGAHFSDEKKIMTDSDLKRFKGAHGLLYEQELGLQ      
fig|553596.3.peg.704   Staphylococcus aureus A9781     MLKMPKEKYYLYREDGTEDIKVIKYKENENEVYSLTGAHFSDEKKIMTDSDLKRFKGAHGLLYEQELGLQATIFDI
fig|553565.3.peg.630   Staphylococcus aureus A5937        MPKEKYYLYREDGTEDIKVIKYKENENEVYSLTGGHFSDEKKIMTDSDLKRFKGAHGLLYEQELGLQATIFDI
fig|1158693.3.peg.1360   Staphylococcus aureus M0692        MPKEKYYLYREDGTEDIKVIKYKENENEVYSLTGAHFSDEKKIMTDSDLKRFKGAHGLLYEQELGLQATIFDI
fig|1116221.3.peg.2742   Staphylococcus aureus subsp. aureus VRS8        MPKEKYYLYREDGTEDIKVIKYKDNANEVYSLTGAHFSDEKKIMTDSDLKRFKGAHGLLYEQELGLQATIFDI
fig|1158693.3.peg.1769   Staphylococcus aureus M0692        MPKEKYYLYREDGTEDIKVIKYKDNANEVYSLTGAHFSDEKKIMTDSDLKRFKGAHGLLYEQELGLQATIFDI
fig|93062.19.peg.332   Staphylococcus aureus subsp. aureus COL     MLKMPKEKYYLYREDGTEDIKVIKYKDNVNEVYSLTGAHFSDEKKIMTDSDLKRFKGAHGLLYEQELGLQATIFDI
fig|1116221.3.peg.2729   Staphylococcus aureus subsp. aureus VRS8        MPKEKYYLYREDGTEDIKVIKYKDNVNEVYSLTGAHFSDEKKIMTESDLKRFKSAHGLLYEQELGLQATIFDI
fig|553594.3.peg.2729   Staphylococcus aureus A9765        MPKEKYYLYREDGTEDIKVIKYKDNVNEVYSLTGAHFSDEKKIMTESDLKRFKSAHGLLYEQELGLQATIFDI
fig|553573.3.peg.2317   Staphylococcus aureus A8115        MPKEKYYLYREDGTEDIKVIKYKDNVNEVYSLTGAHFSDEKKIMTDSDLKRFKSAHGLLYEQELGLQATIFDI
fig|904739.3.peg.2060   Staphylococcus aureus subsp. aureus 21236        MPKEKYYLYREDGTEDIKVIKYKDNVNEVYSLTGAHFSDEKKIMTDSDLKRFKSAHGLLYEQELGLQATIFDI
fig|553574.3.peg.2002   Staphylococcus aureus A8117     MLKMPKEKYYLYREDGTEDIKVIKYKDNVNEVYSLTGAHFSDEKKIMTDSDLKRFKSAHGLLYEQELGLQATIFDI
fig|553581.3.peg.2   Staphylococcus aureus A9299        MPKEKYYLYREDGTEDIKVIKYKDNVNEVYSLTGAHFSDEKKIMTESDLKRFKGAHGLLYEQELGLQATIFDI
fig|904773.3.peg.875   Staphylococcus aureus subsp. aureus 21343        MPKEKYYLYREDGTEDIKVIKYKDNVNEVYSLTGAHFSDEKKIMTESDLKRFKGAHGLLYEQELGLQATIFDI
fig|575608.2.peg.20   Siphoviridae Staphylococcus phage phiSauS-IPLA88        MPKEKYYLYREDGTEDIKVIKYIDNVNEVYSLTGAHFSDEKKIMTDSDLKRFKGAHGLLYEQELGLQATIFDI
fig|585153.3.peg.2163   Staphylococcus aureus subsp. aureus E1410        MPKEKYYLYREDGTEDIKVIKYKDNVNEVYSLTGAHFSDEKKIMTDRDLKRFKGAHGLLYEQELGLQATIFDI
fig|320842.3.peg.30   Bacteriophage 96        MPKEKYYLYREDGTEDIKVIKYKDNVNEVYSLTGAHFSDEKKIMTDSDLKRFKGAHGLLYEQELGLQATIFDI
fig|585155.3.peg.2593   Staphylococcus aureus subsp. aureus H19        MPKEKYYLYREDGTEDIKVIKYKDNVNEVYSLTGAHFSDEKKIMTDSDLKRFKGAHGLLYEQELGLQATIFDI
fig|585152.3.peg.1818   Staphylococcus aureus subsp. aureus D139        MPKEKYYLYREDGTEDIKVIKYKDNVNEVYSLTGAHFSDEKKIMTDSDLKRFKGAHGLLYEQELGLQ      
fig|553573.3.peg.461   Staphylococcus aureus A8115        MPKEKYYLYREDGTEDIKVIKHEDNVNEVYSLTGAHFSDEKKIMADSDLKRFKGAHGLLYEQELGLQATIFDI
fig|904739.3.peg.1292   Staphylococcus aureus subsp. aureus 21236        MPKEKYYLYREDGTEDIKVIKHEDNVNEVYSLTGAHFSDEKKIMADSDLKRFKGAHGLLYEQELGLQATIFDI
fig|904771.3.peg.453   Staphylococcus aureus subsp. aureus 21340        MPKEKYYLYREDGTEDIKVIKHEDNVNEVYSLTGAHFSDEKKIMADSDLKRFKGAHGLLYEQELGLQATIFDI
fig|585150.3.peg.2457   Staphylococcus aureus subsp. aureus C160        MPKEKYYLYREDGTEDIKVIKHEDNVNEVYSLTGAHFSDEKKIMADSDLKRFKSAHGLLYEQELGL       
fig|426430.8.peg.1094   Staphylococcus aureus subsp. aureus str. Newman        MPKEKYYLYREDGTEDIKVIKYKDNVNEVYSLTGAHFSDEKKIMADSDLKRFKGAHGLLYEQELGLQATIFDI
fig|426430.8.peg.1953   Staphylococcus aureus subsp. aureus str. Newman        MPKEKYYLYREDGTEDIKVIKYKDNVNEVYSLTGAHFSDEKKIMADSDLKRFKGAHGLLYEQELGLQATIFDI
fig|426430.8.peg.300   Staphylococcus aureus subsp. aureus str. Newman        MPKEKYYLYREDGTEDIKVIKYKDNVNEVYSLTGAHFSDEKKIMADSDLKRFKGAHGLLYEQELGLQATIFDI
fig|553581.3.peg.452   Staphylococcus aureus A9299        MPKEKYYLYREDGAEDIKVIKYKDNVNEVYSLTGAHFSDEKKIMTDSDLKRFKGAHGLLYEQELGLQATIFDI
fig|546342.3.peg.2481   Staphylococcus aureus subsp. aureus str. JKD6008        MPKEKYYLYREDGTEDIKVIKYKDNVNEVYSLSGAHFSDEKKIMTDSDLKRFKGAHGLLYEHQLGLQATIFDI
fig|585153.3.peg.2612   Staphylococcus aureus subsp. aureus E1410        MPKEKYYLYREDGTEDIKVIKYKDNVNEVYSLSRAHFSDEKKIMTDRDLKRFKGAHGLLYEHQLGLQATIFDI
fig|585149.6.peg.2166   Staphylococcus aureus subsp. aureus C101        MPKEKYYLYREDGTEDIKVIKYKDNVNEVYSLSRAHFSDEKKIMTDSDLKRFKGAHGLLYEHQLGLQATIFDI