(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00016075

fig|693750.4.peg.2556   Brucella sp. BO2                                                                               LKRVLED−−ASILKIAQNMKYDWLVMRR−−−H−−−−−−−−−−−−−−−−−−−−−GINAVSF−−−−−DDTMLISYVLDAGTG−−SHGMDPLS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ERW−−−LGHTPIAYKDVAGSG−−−KSAVTFDMVDI−−−−−−−−−−−−−−−−−−−−−DRATAYAAEDADVTLRLWQVLKP−−−RLAAEGLMSVYERLERPLVDVLARMEERGIAVDRQVLSRLSGDLAQAAAAYEDEIYA−−−−−−−−−−LA−−GEKFTIGSPKQLGDILFGKMGLPGA−−−SKTKTGQWSTSAQVL−−EDLA−−−AEGHPLPRKIVDWRQLTKLKSTYTDALPGFINPQTKRVHTSYAMASTSTGRLSSSDPNLQNIPVR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TAEGRKIRTAFIAEP−−−−−−−−−−−−−−−−−−−−GNKLISADYSQIELRVLAHVADIAQLKQAFAD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GIDIHAMTASEMFGVPVEGMP−−−−S−−−−−EVRRRAKAINFGIIYGISAFGL−−−−ANQL−−−−−SIPREEAG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QYIRTYFERFPGIKDYMEATKAFAREH−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GYVETIFGRRAHYPD−−−−−−−−−−−−−−−−−−−−−−−−−−I−−−−−−RASNPQVR−−−−−−−−−−−−−−−−−−−−−−AFNERAAINAPIQGAAADIIRRAMIRMEDALAKENLAARMLLQVHDELIFEVPENEVEKTIPVVRRVMENAAMPAVSLAVP−−−−−−−−LRVD
fig|520488.3.peg.878   Brucella suis bv. 4 str. 40                                                                               LKRVLED−−ASILKIAQNMKYDWLVMRR−−−H−−−−−−−−−−−−−−−−−−−−−GINAVSF−−−−−DDTMLISYVLDAGTG−−SHGMDPLS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ERW−−−LGHTPIAYKDVAGSG−−−KSAVTFDMVDI−−−−−−−−−−−−−−−−−−−−−DRATAYAAEDADVTLRLWQVLKP−−−RLAAEGLMSVYERLERPLVDVLARMEERGIAVDRQVLSRLSGDLAQAAAAYEDEIYA−−−−−−−−−−LA−−GEKFTIGSPKQLGDILFGKMGLPGA−−−SKTKTGQWSTSAQVL−−EDLA−−−AEGHPLPRKIVDWRQLTKLKSTYTDALPGFINPQTKRVHTSYAMASTSTGRLSSSDPNLQNIPVR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TAEGRKIRTAFIAEP−−−−−−−−−−−−−−−−−−−−GNKLISADYSQIELRVLAHVADIAQLKQAFAD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GIDIHAMTASEMFGVPVEGMP−−−−S−−−−−EVRRRAKAINFGIIYGISAFGL−−−−ANQL−−−−−SIPREEAG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QYIRTYFERFPGIKDYMEATKAFAREH−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GYVETIFGRRAHYPD−−−−−−−−−−−−−−−−−−−−−−−−−−I−−−−−−RASNPQVR−−−−−−−−−−−−−−−−−−−−−−AFNERAAINAPIQGAAADIIRRAMIRMEDALAKENLAARMLLQVHDELIFEVPENEVEKTIPVVRRVMENAAMPAVSLAVP−−−−−−−−LRVD
fig|1160214.3.peg.1894   Brucella melitensis UK22/04                                                                               LKRVLED−−ASILKIAQNMKYDWLVMRR−−−H−−−−−−−−−−−−−−−−−−−−−GINAVSF−−−−−DDTMLISYVLDAGTG−−SHGMDPLS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ERW−−−LGHTPIAYKDVAGSG−−−KSAVTFDMVDI−−−−−−−−−−−−−−−−−−−−−DRATAYAAEDADVTLRLWQVLKP−−−RLAAEGLMSVYERLERPLVDVLARMEERGIAVDRQVLSRLSGDLAQAAAAYEDEIYA−−−−−−−−−−LA−−GEKFTIGSPKQLGDILFGKMGLPGA−−−SKTKTGQWSTSAQVL−−EDLA−−−AEGHPLPRKIVDWRQLTKLKSTYTDALPGFINPQTKRVHTSYAMASTSTGRLSSSDPNLQNIPVR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TAEGRKIRTAFIAEP−−−−−−−−−−−−−−−−−−−−GNKLISADYSQIELRVLAHVADIAQLKQAFAD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GIDIHAMTASEMFGVPVEGMP−−−−S−−−−−EVRRRAKAINFGIIYGISAFGL−−−−ANQL−−−−−SIPREEAG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QYIRTYFERFPGIKDYMEATKAFAREH−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GYVETIFGRRAHYPD−−−−−−−−−−−−−−−−−−−−−−−−−−I−−−−−−RASNPQVR−−−−−−−−−−−−−−−−−−−−−−AFNERAAINAPIQGAAADIIRRAMIRMEDALAKENLAARMLLQVHDELIFEVPENEVEKTIPVVRRVMENAAMPAVSLAVP−−−−−−−−LRVD
fig|437670.3.peg.101   Brucella sp. F23/97                                                                               LKRVLED−−ASILKIAQNMKYDWLVMRR−−−H−−−−−−−−−−−−−−−−−−−−−GINAVSF−−−−−DDTMLISYVLDAGTG−−SHGMDPLS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ERW−−−LGHTPIAYKDVAGSG−−−KSAVTFDMVDI−−−−−−−−−−−−−−−−−−−−−DRATAYAAEDADVTLRLWQVLKP−−−RLAAEGLMSVYERLERPLVDVLARMEERGIAVDRQVLSRLSGDLAQAAAAYEDEIYA−−−−−−−−−−LA−−GEKFTIGSPKQLGDILFGKMGLPGA−−−SKTKTGQWSTSAQVL−−EDLA−−−AEGHPLPRKIVDWRQLTKLKSTYTDALPGFINPQTKRVHTSYAMASTSTGRLSSSDPNLQNIPVR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TAEGRKIRTAFIAEP−−−−−−−−−−−−−−−−−−−−GNKLISADYSQIELRVLAHVADIAQLKQAFAD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GIDIHAMTASEMFGVPVEGMP−−−−S−−−−−EVRRRAKAINFGIIYGISAFGL−−−−ANQL−−−−−SIPREEAG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QYIRTYFERFPGIKDYMEATKAFAREH−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GYVETIFGRRAHYPD−−−−−−−−−−−−−−−−−−−−−−−−−−I−−−−−−RASNPQVR−−−−−−−−−−−−−−−−−−−−−−AFNERAAINAPIQGAAADIIRRAMIRMEDALAKENLAARMLLQVHDELIFEVPENEVEKTIPVVRRVMENAAMPAVSLAVP−−−−−−−−LRVD
fig|520466.3.peg.1571   Brucella melitensis bv. 3 str. Ether                                                                               LKRVLED−−ASILKIAQNMKYDWLVMRR−−−H−−−−−−−−−−−−−−−−−−−−−GINAVSF−−−−−DDTMLISYVLDAGTG−−SHGMDPLS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ERW−−−LGHTPIAYKDVAGSG−−−KSAVTFDMVDI−−−−−−−−−−−−−−−−−−−−−DRATAYAAEDADVTLRLWQVLKP−−−RLAAEGLMSVYERLERPLVDVLARMEERGIAVDRQVLSRLSGDLAQAAAAYEDEIYA−−−−−−−−−−LA−−GEKFTIGSPKQLGDILFGKMGLPGA−−−SKTKTGQWSTSAQVL−−EDLA−−−AEGHPLPRKIVDWRQLTKLKSTYTDALPGFINPQTKRVHTSYAMASTSTGRLSSSDPNLQNIPVR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TAEGRKIRTAFIAEP−−−−−−−−−−−−−−−−−−−−GNKLISADYSQIELRVLAHVADIAQLKQAFAD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GIDIHAMTASEMFGVPVEGMP−−−−S−−−−−EVRRRAKAINFGIIYGISAFGL−−−−ANQL−−−−−SIPREEAG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QYIRTYFERFPGIKDYMEATKAFAREH−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GYVETIFGRRAHYPD−−−−−−−−−−−−−−−−−−−−−−−−−−I−−−−−−RASNPQVR−−−−−−−−−−−−−−−−−−−−−−AFNERAAINAPIQGAAADIIRRAMIRMEDALAKENLAARMLLQVHDELIFEVPENEVEKTIPVVRRVMENAAMPAVSLAVP−−−−−−−−LRVD
fig|595497.3.peg.311   Brucella ceti str. Cudo                                                                               LKRVLED−−ASILKIAQNMKYDWLVMRR−−−H−−−−−−−−−−−−−−−−−−−−−GINAVSF−−−−−DDTMLISYVLDAGTG−−SHGMDPLS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ERW−−−LGHTPIAYKDVAGSG−−−KSAVTFDMVDI−−−−−−−−−−−−−−−−−−−−−DRATAYAAEDADVTLRLWQVLKP−−−RLAAEGLMSVYERLERPLVDVLARMEERGIAVDRQVLSRLSGDLAQAAAAYEDEIYA−−−−−−−−−−LA−−GEKFTIGSPKQLGDILFGKMGLPGA−−−SKTKTGQWSTSAQVL−−EDLA−−−AEGHPLPRKIVDWRQLTKLKSTYTDALPGFINPQTKRVHTSYAMASTSTGRLSSSDPNLQNIPVR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TAEGRKIRTAFIAEP−−−−−−−−−−−−−−−−−−−−GNKLISADYSQIELRVLAHVADIAQLKQAFAD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GIDIHAMTASEMFGVPVEGMP−−−−S−−−−−EVRRRAKAINFGIIYGISAFGL−−−−ANQL−−−−−SIPREEAG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QYIRTYFERFPGIKDYMEATKAFAREH−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GYVETIFGRRAHYPD−−−−−−−−−−−−−−−−−−−−−−−−−−I−−−−−−RASNPQVR−−−−−−−−−−−−−−−−−−−−−−AFNERAAINAPIQGAAADIIRRAMIRMEDALAKENLAARMLLQVHDELIFEVPENEVEKTIPVVRRVMENAAMPAVSLAVP−−−−−−−−LRVD
fig|520489.3.peg.1552   Brucella suis bv. 5 str. 513                                                                               LKRVLED−−ASILKIAQNMKYDWLVMRR−−−H−−−−−−−−−−−−−−−−−−−−−GINAVSF−−−−−DDTMLISYVLDAGTG−−SHGMDPLS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ERW−−−LGHTPIAYKDVAGSG−−−KSAVTFDMVDI−−−−−−−−−−−−−−−−−−−−−DRATAYAAEDADVTLRLWQVLKP−−−RLAAEGLMSVYERLERPLVDVLARMEERGIAVDRQVLSRLSGDLAQAAAAYEDEIYA−−−−−−−−−−LA−−GEKFTIGSPKQLGDILFGKMGLPGA−−−SKTKTGQWSTSAQVL−−EDLA−−−AEGHPLPRKIVDWRQLTKLKSTYTDALPGFINPQTKRVHTSYAMASTSTGRLSSSDPNLQNIPVR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TAEGRKIRTAFIAEP−−−−−−−−−−−−−−−−−−−−GNKLISADYSQIELRVLAHVADIAQLKQAFAD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GIDIHAMTASEMFGVPVEGMP−−−−S−−−−−EVRRRAKAINFGIIYGISAFGL−−−−ANQL−−−−−SIPREEAG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QYIRTYFERFPGIKDYMEATKAFAREH−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GYVETIFGRRAHYPD−−−−−−−−−−−−−−−−−−−−−−−−−−I−−−−−−RASNPQVR−−−−−−−−−−−−−−−−−−−−−−AFNERAAINAPIQGAAADIIRRAMIRMEDALAKENLAARMLLQVHDELIFEVPENEVEKTIPVVRRVMENAAMPAVSLAVP−−−−−−−−LRVD
fig|1160234.3.peg.4   Brucella sp. UK38/05                                                                               LKRVLED−−ASILKIAQNMKYDWLVMRR−−−H−−−−−−−−−−−−−−−−−−−−−GINAVSF−−−−−DDTMLISYVLDAGTG−−SHGMDPLS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ERW−−−LGHTPIAYKDVAGSG−−−KSAVTFDMVDI−−−−−−−−−−−−−−−−−−−−−DRATAYAAEDADVTLRLWQVLKP−−−RLAAEGLMSVYERLERPLVDVLARMEERGIAVDRQVLSRLSGDLAQAAAAYEDEIYA−−−−−−−−−−LA−−GEKFTIGSPKQLGDILFGKMGLPGA−−−SKTKTGQWSTSAQVL−−EDLA−−−AEGHPLPRKIVDWRQLTKLKSTYTDALPGFINPQTKRVHTSYAMASTSTGRLSSSDPNLQNIPVR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TAEGRKIRTAFIAEP−−−−−−−−−−−−−−−−−−−−GNKLISADYSQIELRVLAHVADIAQLKQAFAD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GIDIHAMTASEMFGVPVEGMP−−−−S−−−−−EVRRRAKAINFGIIYGISAFGL−−−−ANQL−−−−−SIPREEAG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QYIRTYFERFPGIKDYMEATKAFAREH−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GYVETIFGRRAHYPD−−−−−−−−−−−−−−−−−−−−−−−−−−I−−−−−−RASNPQVR−−−−−−−−−−−−−−−−−−−−−−AFNERAAINAPIQGAAADIIRRAMIRMEDALAKENLAARMLLQVHDELIFEVPENEVEKTIPVVRRVMENAAMPAVSLAVP−−−−−−−−LRVD
fig|1169242.3.peg.96   Brucella suis F8/06-1                                                                               LKRVLED−−ASILKIAQNMKYDWLVMRR−−−H−−−−−−−−−−−−−−−−−−−−−GINAVSF−−−−−DDTMLISYVLDAGTG−−SHGMDPLS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ERW−−−LGHTPIAYKDVAGSG−−−KSAVTFDMVDI−−−−−−−−−−−−−−−−−−−−−DRATAYAAEDADVTLRLWQVLKP−−−RLAAEGLMSVYERLERPLVDVLARMEERGIAVDRQVLSRLSGDLAQAAAAYEDEIYA−−−−−−−−−−LA−−GEKFTIGSPKQLGDILFGKMGLPGA−−−SKTKTGQWSTSAQVL−−EDLA−−−AEGHPLPRKIVDWRQLTKLKSTYTDALPGFINPQTKRVHTSYAMASTSTGRLSSSDPNLQNIPVR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TAEGRKIRTAFIAEP−−−−−−−−−−−−−−−−−−−−GNKLISADYSQIELRVLAHVADIAQLKQAFAD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GIDIHAMTASEMFGVPVEGMP−−−−S−−−−−EVRRRAKAINFGIIYGISAFGL−−−−ANQL−−−−−SIPREEAG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QYIRTYFERFPGIKDYMEATKAFAREH−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GYVETIFGRRAHYPD−−−−−−−−−−−−−−−−−−−−−−−−−−I−−−−−−RASNPQVR−−−−−−−−−−−−−−−−−−−−−−AFNERAAINAPIQGAAADIIRRAMIRMEDALAKENLAARMLLQVHDELIFEVPENEVEKTIPVVRRVMENAAMPAVSLAVP−−−−−−−−LRVD
fig|1004956.3.peg.3139   Brucella melitensis bv. 1 str. M28-12                                                                               LKRVLED−−ASILKIAQNMKYDWLVMRR−−−H−−−−−−−−−−−−−−−−−−−−−GINAVSF−−−−−DDTMLISYVLDAGTD−−SHGMDPLS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ERW−−−LGHTPIAYKDVAGSG−−−KSAVTFDMVDI−−−−−−−−−−−−−−−−−−−−−DRATAYAAEDADVTLRLWQVLKP−−−RLAAEGLMSVYERLERPLVDVLARMEERGIAVDRQVLSRLSGDLAQAAAAYEDEIYA−−−−−−−−−−LA−−GEKFTIGSPKQLGDILFGKMGLPGA−−−SKTKTGQWSTSAQVL−−EDLA−−−AEGHPLPRKIVDWRQLTKLKSTYTDALPGFINPQTKRVHTSYAMASTSTGRLSSSDPNLQNIPVR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TAEGRKIRTAFIAEP−−−−−−−−−−−−−−−−−−−−GNKLISADYSQIELRVLAHVADIAQLKQAFAD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GIDIHAMTASEMFGVPVEGMP−−−−S−−−−−EVRRRAKAINFGIIYGISAFGL−−−−ANQL−−−−−SIPREEAG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QYIRTYFERFPGIKDYMEATKAFAREH−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GYVETIFGRRAHYPD−−−−−−−−−−−−−−−−−−−−−−−−−−I−−−−−−RASNPQVR−−−−−−−−−−−−−−−−−−−−−−AFNERAAINAPIQGAAADIIRRAMIRMEDALAKENLAARMLLQVHDELIFEVPENEVEKTIPVVRRVMENAAMPAVSLAVP−−−−−−−−LRVD
fig|470735.4.peg.1137   Brucella sp. BO1                                                                               LKRVLED−−ASILKIAQNMKYDWLVMRR−−−H−−−−−−−−−−−−−−−−−−−−−GINAVSF−−−−−DDTMLISYVLDAGTG−−SHGMDPLS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ERW−−−LGHTPIAYKDVAGSG−−−KSAVTFDMVDI−−−−−−−−−−−−−−−−−−−−−DRATAYAAEDADVTLRLWQVLKP−−−RLAAEGLMSVYERLERPLVDVLARMEERGIAVDRQVLSRLSGDLAQAAAAYEDEIYA−−−−−−−−−−LA−−GEKFTISSPKQLGDILFGKMGLPGA−−−SKTKTGQWSTSAQVL−−EDLA−−−AEGHPLPRKIVDWRQLTKLKSTYTDALPGFINPQTKRVHTSYAMASTSTGRLSSSDPNLQNIPVR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TAEGRKIRTAFIAEP−−−−−−−−−−−−−−−−−−−−GNKLISADYSQIELRVLAHVADIAQLKQAFAD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GIDIHAMTASEMFGVPVEGMP−−−−S−−−−−EVRRRAKAINFGIIYGISAFGL−−−−ANQL−−−−−SIPREEAG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QYIRTYFERFPGIKDYMEATKAFAREH−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GYVETIFGRRAHYPD−−−−−−−−−−−−−−−−−−−−−−−−−−I−−−−−−RASNPQVR−−−−−−−−−−−−−−−−−−−−−−AFNERAAINAPIQGAAADIIRRAMIRMEDALAKENLAARMLLQVHDELIFEVPENEVEKTIPVVRRVMENAAMPAVSLAVP−−−−−−−−LRVD
fig|520448.3.peg.315   Brucella sp. NVSL 07-0026                                                                               LKRVLED−−ASILKIAQNMKYDWLVMRR−−−H−−−−−−−−−−−−−−−−−−−−−GINAVSF−−−−−DDTMLISYVLDAGTG−−SHGMDPLS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ERW−−−LGHTPIAYKDVAGSG−−−KSAVTFDMVDI−−−−−−−−−−−−−−−−−−−−−DRATAYAAEDADVTLRLWQVLKP−−−RLAAEGLMSVYERLERPLVDVLARMEERGIAVDRQVLSRLSGDLVQAAAAYEDEIYA−−−−−−−−−−LA−−GEKFTIGSPKQLGDILFGKMGLPGA−−−SKTKTGQWSTSAQVL−−EDLA−−−AEGHPLPRKIVDWRQLTKLKSTYTDALPGFINPQTKRVHTSYAMASTSTGRLSSSDPNLQNIPVR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TAEGRKIRTAFIAEP−−−−−−−−−−−−−−−−−−−−GNKLISADYSQIELRVLAHVADIAQLKQAFAD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GIDIHAMTASEMFGVPVEGMP−−−−S−−−−−EVRRRAKAINFGIIYGISAFGL−−−−ANQL−−−−−SIPREEAG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QYIRTYFERFPGIKDYMEATKAFAREH−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GYVETIFGRRAHYPD−−−−−−−−−−−−−−−−−−−−−−−−−−I−−−−−−RASNPQVR−−−−−−−−−−−−−−−−−−−−−−AFNERAAINAPIQGAAADIIRRAMIRMEDALAKENLAARMLLQVHDELIFEVPENEVEKTIPVVRRVMENAAMPAVSLAVP−−−−−−−−LRVD
fig|1293914.3.peg.102   Brucella ovis IntaBari-2010-47-268                                                                               LKRVLED−−ASILKIAQNMKYDWLVMRR−−−H−−−−−−−−−−−−−−−−−−−−−GINAVSF−−−−−DDTMLISYVLDAGTG−−RHGMDPLS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ERW−−−LGHTPIAYKDVAGSG−−−KSAVTFDMVDI−−−−−−−−−−−−−−−−−−−−−DRATAYAAEDADVTLRLWQVLKP−−−RLAAEGLMSVYERLERPLVDVLARMEERGIAVDRQVLSRLSGDLAQAAAAYEDEIYA−−−−−−−−−−LA−−GEKFTIGSPKQLGDILFGKMGLPGA−−−SKTKTGQWSTSAQVL−−EDLA−−−AEGHPLPRKIVDWRQLTKLKSTYTDALPGFINPQTKRVHTSYAMASTSTGRLSSSDPNLQNIPVR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TAEGRKIRTAFIAEP−−−−−−−−−−−−−−−−−−−−GNKLISADYSQIELRVLAHVADIAQLKQAFAD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GIDIHAMTASEMFGVPVEGMP−−−−S−−−−−EVRRRAKAINFGIIYGISAFGL−−−−ANQL−−−−−SIPREEAG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QYIRTYFERFPGIKDYMEATKAFAREH−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GYVETIFGRRAHYPD−−−−−−−−−−−−−−−−−−−−−−−−−−I−−−−−−RASNPQVR−−−−−−−−−−−−−−−−−−−−−−AFNERAAINAPIQGAAADIIRRAMIRMEDALAKENLAARMLLQVHDELIFEVPENEVEKTIPVVRRVMENAAMPAVSLAVP−−−−−−−−LRVD
fig|1198681.3.peg.13   Brucella melitensis CNGB 290                                                                               LKRVLED−−ASILKIAQNMKYDWLVMRR−−−H−−−−−−−−−−−−−−−−−−−−−GINAVSF−−−−−DDTMLISYVLDAGTG−−SHGMDPLS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ERW−−−LGHTPIAYKDVAGSG−−−KSAVTFDMVDI−−−−−−−−−−−−−−−−−−−−−DRATAYAAEDADVTLRLWQVLKP−−−RLAAEGLMSVYERLERPLVDVLARMEERGIAVDRQVLSRLSGDLAQAAAAYEDEIYA−−−−−−−−−−LA−−GEKFTIGSPKQLGDILFGKMGLPGA−−−SKTKTGQWSTSAQVL−−EDLA−−−AEGHPLPRKIVDWRQLTKLKSTYTDALPGFINPQTKRVHTSYAMASTSTGRLSSSDPNLQNIPVR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TAEGRKIRTAFIAEP−−−−−−−−−−−−−−−−−−−−GNKLISADYSQIELRILAHVADIAQLKQAFAD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GIDIHAMTASEMFGVPVEGMP−−−−S−−−−−EVRRRAKAINFGIIYGISAFGL−−−−ANQL−−−−−SIPREEAG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QYIRTYFERFPGIKDYMEATKAFAREH−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GYVETIFGRRAHYPD−−−−−−−−−−−−−−−−−−−−−−−−−−I−−−−−−RASNPQVR−−−−−−−−−−−−−−−−−−−−−−AFNERAAINAPIQGAAADIIRRAMIRMEDALAKENLAARMLLQVHDELIFEVPENEVEKTIPVVRRVMENAAMPAVSLAVP−−−−−−−−LRVD
fig|224914.1.peg.1824   Brucella melitensis 16M                                                                               LKRVLED−−ASILKIAQNMKYDWLVMRR−−−H−−−−−−−−−−−−−−−−−−−−−GINAVSF−−−−−DDTMLISYVLDAGTG−−SHGMDPLS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ERW−−−LGHTPIAYKDVAGSG−−−KSAVTFDMVDI−−−−−−−−−−−−−−−−−−−−−DRATAYAAEDADVTLRLWQVLKP−−−RLAAEGLMSVYERLERPLVDVLARMEERGIAVDRQVLSRLSGDLAQAAAAYEDEIYA−−−−−−−−−−LA−−GEKFTIGSPKQLGDILFGKMGLPGA−−−SKTKTGQWSTSAQVL−−EDLA−−−AEGHPLPRKIVDWRQLTKLKSTYTDALPGFINPQTKRVHTSYAMASTSTGRLSSSDPNLQNIPVR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TAEGRKIRTAFIAEP−−−−−−−−−−−−−−−−−−−−GNKLISADYSQIELRILAHVADIAQLKQAFAD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GIDIHAMTASEMFGVPVEGMP−−−−S−−−−−EVRRRAKAINFGIIYGISAFGL−−−−ANQL−−−−−SIPREEAG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QYIRTYFERFPGIKDYMEATKAFAREH−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GYVETIFGRRAHYPD−−−−−−−−−−−−−−−−−−−−−−−−−−I−−−−−−RASNPQVR−−−−−−−−−−−−−−−−−−−−−−AFNERAAINAPIQGAAADIIRRAMIRMEDALAKENLAARMLLQVHDELIFEVPENEVEKTIPVVRRVMENAAMPAVSLAVP−−−−−−−−LRVD
fig|1169218.3.peg.2018   Brucella abortus F1/06-B21                                                                               LKRVLED−−ASILKIAQNMKYDWLVMRR−−−H−−−−−−−−−−−−−−−−−−−−−GINAVSF−−−−−DDTMLISYVLDAGTG−−SHGMAPLS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ERW−−−LGHTPIAYKDVAGSG−−−KSAVTFDMVDI−−−−−−−−−−−−−−−−−−−−−DRATAYAAEDADVTLRLWQVLKP−−−RLAAEGLMSVYERLERPLVDVLARMEERGIAVDRQVLSRLSGDLAQAAAAYEDEIYA−−−−−−−−−−LA−−GEKFTIGSPKQLGDILFGKMGLPGA−−−SKTKTGQWSTSAQVL−−EDLA−−−AEGHPLLRKIVDWRQLTKLKSTYTDALPGFINPQTKRVHTSYAMASTSTGRLSSSDPNLQNIPVR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TAEGRKIRTAFIAEP−−−−−−−−−−−−−−−−−−−−GNKLISADYSQIELRVLAHVADIAQLKQAFAD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GIDIHAMTASEMFGVPVEGMP−−−−S−−−−−EVRRRAKAINFGIIYGISAFGL−−−−ANQL−−−−−SIPREEAG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QYIRTYFERFPGIKDYMEATKAFAREH−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GYVETIFGRRTHYPD−−−−−−−−−−−−−−−−−−−−−−−−−−I−−−−−−RASNPQVR−−−−−−−−−−−−−−−−−−−−−−AFNERAAINAPIQGAAADIIRRAMIRMEDALAKENLAARMLLQVHDELIFEVPENEVEKTIPVVRRVMENAAMPAVSLAVP−−−−−−−−LRVD
fig|35802.63.peg.2627   Brucella abortus bv. 1 str. B12-0270                                                                               LKRVLED−−ASILKIAQNMKYDWLVMRR−−−H−−−−−−−−−−−−−−−−−−−−−GINAVSF−−−−−DDTMLISYVLDAGTG−−SHGMDPLS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ERW−−−LGHTPIAYKDVAGSG−−−KSAVTFDMVDI−−−−−−−−−−−−−−−−−−−−−DRATAYAAEDADVTLRLWQVLKP−−−RLAAEGLMSVYERLERPLVDVLARMEERGIAVDRQVLSRLSGDLAQAAAAYEDEIYA−−−−−−−−−−LA−−GEKFTIGSPKQLGDILFGKMGLPGA−−−SKTKTGQWSTSAQVL−−EDLA−−−AEGHPLLRKIVDWRQLTKLKSTYTDALPGFINPQTKRVHTSYAMASTSTGRLSSSDPNLQNIPVR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TAEGRKIRTAFIAEP−−−−−−−−−−−−−−−−−−−−GNKLISADYSQIELRVLAHVADIAQLKQAFAD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GIDIHAMTASEMFGVPVEGMP−−−−S−−−−−EVRRRAKAINFGIIYGISAFGL−−−−ANQL−−−−−SIPREEAG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QYIRTYFERFPGIKDYMEATKAFAREH−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GYVETIFGRRTHYPD−−−−−−−−−−−−−−−−−−−−−−−−−−I−−−−−−RASNPQVR−−−−−−−−−−−−−−−−−−−−−−AFNERAAINAPIQGAAADIIRRAMIRMEDALAKENLAARMLLQVHDELIFEVPENEVEKTIPVVRRVMENAAMPAVSLAVP−−−−−−−−LRVD
fig|520449.3.peg.53   Brucella sp. 83/13                                                                               LKHVLED−−ASILKIAQNMKYDWLVMRR−−−H−−−−−−−−−−−−−−−−−−−−−GINAVSF−−−−−DDTMLISYVLDAGTG−−SHGMNPLS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ERW−−−LGHTPIAYKDVAGSG−−−KSAVTFDMVDI−−−−−−−−−−−−−−−−−−−−−DRATAYAAEDADVTLRLWQVLKP−−−RLAAEGLMSVYERLERPLVDVLARMEERGIAVDRQVLSRLSGDLAQAAAAYEDEIYA−−−−−−−−−−LA−−GEKFTIGSPKQLGDILFGKMGLPGA−−−SKTKTGQWSTSAQVL−−EDLA−−−AEGHPLPRKIVDWRQLTKLKSTYTDALPGFINPQTKRVHTSYAMASTSTGRLSSSDPNLQNIPVR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TAEGRKIRTAFIAEP−−−−−−−−−−−−−−−−−−−−GNKLISADYSQIELRVLAHVADIAQLKQAFAD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GIDIHAMTASEMFGVPVEGMP−−−−S−−−−−EVRRRAKAINFGIIYGISAFGL−−−−ANQL−−−−−SIPREEAG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QYIRTYFERFPGIKDYMEATKAFAREH−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GYVETIFGRRAHYPD−−−−−−−−−−−−−−−−−−−−−−−−−−I−−−−−−RASNPQVR−−−−−−−−−−−−−−−−−−−−−−AFNERAAINAPIQGAAADIIRRAMIRMEDALAKENLAARMLLQVHDELIFEVPENEVEKTIPVVRHVMENAAMPAVSLAVP−−−−−−−−LRVD
fig|1234597.4.peg.1130   Ochrobactrum intermedium M86                                                                     GEALA−−−−ALKTVLED−−ASVLKIAQNMKYDWLIMRR−−−Y−−−−−−−−−−−−−−−−−−−−−GINTVSF−−−−−DDTMLISYVLDAGTG−−SHGMDPLS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ERW−−−LGHTPIAYKDVAGSG−−−KSSVTFDMVDI−−−−−−−−−−−−−−−−−−−−−DRATAYAAEDADVTLRLWQVLKP−−−RLAAEGLMSVYERLERPLVDVLARMEERGIAVDRQVLSRLSGDLAQAAAAYEDEIYE−−−−−−−−−−LA−−GERFTIGSPKQLGDILFGKMGLPGA−−−SKTKTGQWSTSAQVL−−EDLA−−−AEGHPLPRKIVDWRQLTKLKSTYTDALPGFINPATRRVHTCYAMASTSTGRLSSSDPNLQNIPVR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TAEGRKIRTAFIAEP−−−−−−−−−−−−−−−−−−−−GNKLISADYSQIELRVLAHVADIAQLKQAFAD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GIDIHAMTASEMFGVPVEGMP−−−−S−−−−−EVRRRAKAINFGIIYGISAFGL−−−−ANQL−−−−−SIPREEAG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QYIRTYFERFPGIKDYMEATKAFAREH−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GYVETIFGRRAHYPD−−−−−−−−−−−−−−−−−−−−−−−−−−I−−−−−−RASNPQIR−−−−−−−−−−−−−−−−−−−−−−AFNERAAINAPIQGSAADIIRRAMIRMEDALAKEKLAARMLLQVHDELIFEVPENEVEKTVSVVRHVM                         
fig|439375.7.peg.146   Ochrobactrum anthropi ATCC 49188                                                                 QIPLDEALA−−−−ALKIVLED−−ASVLKIAQNMKYDWLVMRR−−−H−−−−−−−−−−−−−−−−−−−−−GINTVSF−−−−−DDTMLISYVLDAGTG−−SHGMDPLS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ERW−−−LGHTPIPYKDVAGSG−−−KSAVSFDMVDL−−−−−−−−−−−−−−−−−−−−−DRATAYAAEDADVTLRLWQVLKP−−−RLAAEGLMSVYERLERPLVDVLACMEERGIAVDRQVLSRLSGDLAQAAAAYEDEIYE−−−−−−−−−−LA−−GERFNIGSPKQLGDILFGKMSLSGA−−−SKTKTGQWSTSAQVL−−EDLA−−−AEGHPLPRKIVDWRQLTKLKSTYTDALPGFINPETKRVHTSYAMASTSTGRLSSSDPNLQNIPVR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TAEGRKIRTAFIAEP−−−−−−−−−−−−−−−−−−−−GNKLVSADYSQIELRVLAHVADIAQLKQAFAD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GIDIHAMTASEMFGVPVEGMP−−−−S−−−−−EVRRRAKAINFGIIYGISAFGL−−−−ANQL−−−−−SIPREEAG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QYIRTYFERFPGIKDYMEATKAFAREN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GYVETIFGRRAHYPD−−−−−−−−−−−−−−−−−−−−−−−−−−I−−−−−−RASNPQVR−−−−−−−−−−−−−−−−−−−−−−AFNERAAINAPIQGSAADIIRRAMIRMEDALAEQNLAARMLLQVHDELIFEVPDNEVEKTIPVVRHIM                         
fig|176299.10.peg.103   Agrobacterium tumefaciens str. C58                                                                         E−−−−RLKDLLED−−EAVLKVAQNLKYDYLLMKR−−−H−−−−−−−−−−−−−−−−−−−−−GVVMRSF−−−−−DDTMLISYVLEAGKT−−THGMDTLS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ERW−−−LGHTPIAYKDVTGSG−−−KSSITFDFVNI−−−−−−−−−−−−−−−−−−−−−DKATAYAAEDADVTLRLWMALKP−−−RLVSERLTKVYERLERPLVPVLAHMEERGITVDRQILSRLSGELAQKAASFEEEIYE−−−−−−−−−−LA−−GERFNIGSPKQLGDILFGRMGLPGG−−−SKTKTGQWSTSAQVL−−EDLA−−−AEGAELPRKIVDWRQLTKLKSTYTDALPSYIHPETKRVHTSYALASTTTGRLSSSEPNLQNIPVR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TAEGRKIRTAFISTP−−−−−−−−−−−−−−−−−−−−GHKLLSADYSQIELRVLAHVADIPQLRNAFEN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GIDIHAMTASEMFGVPVEGMP−−−−S−−−−−EVRRRAKAINFGIIYGISAFGL−−−−ANQL−−−−−SIARSEAG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DYIKKYFERFPGIRDYMEATKAFAREN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GYVETIFGRRAHYPE−−−−−−−−−−−−−−−−−−−−−−−−−−I−−−−−−RSSNPSVK−−−−−−−−−−−−−−−−−−−−−−AFNERAAINAPIQGSAADIIRRAMIRIEPALEAEKLSARMLLQVHDELIFEVEEAEIEKTLPVVVSVMEDAAMPAISMRVP−−−−−−−−LKVD
fig|176299.3.peg.877   Agrobacterium tumefaciens str. C58                                                                         E−−−−RLKDLLED−−EAVLKVAQNLKYDYLLMKR−−−H−−−−−−−−−−−−−−−−−−−−−GVVMRSF−−−−−DDTMLISYVLEAGKT−−THGMDTLS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ERW−−−LGHTPIAYKDVTGSG−−−KSSITFDFVNI−−−−−−−−−−−−−−−−−−−−−DKATAYAAEDADVTLRLWMALKP−−−RLVSERLTKVYERLERPLVPVLAHMEERGITVDRQILSRLSGELAQKAASFEEEIYE−−−−−−−−−−LA−−GERFNIGSPKQLGDILFGRMGLPGG−−−SKTKTGQWSTSAQVL−−EDLA−−−AEGAELPRKIVDWRQLTKLKSTYTDALPSYIHPETKRVHTSYALASTTTGRLSSSEPNLQNIPVR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TAEGRKIRTAFISTP−−−−−−−−−−−−−−−−−−−−GHKLLSADYSQIELRVLAHVADIPQLRNAFEN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GIDIHAMTASEMFGVPVEGMP−−−−S−−−−−EVRRRAKAINFGIIYGISAFGL−−−−ANQL−−−−−SIARSEAG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DYIKKYFERFPGIRDYMEATKAFAREN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GYVETIFGRRAHYPE−−−−−−−−−−−−−−−−−−−−−−−−−−I−−−−−−RSSNPSVK−−−−−−−−−−−−−−−−−−−−−−AFNERAAINAPIQGSAADIIRRAMIRIEPALEAEKLSARMLLQVHDELIFEVEEAEIEKTLPVVVSVMEDAAMPAISMRVP−−−−−−−−LKVD
fig|316058.9.peg.847   Rhodopseudomonas palustris HaA2                                                                      DVLD−−−−ALRPLLDS−−AGLAKIGFNIKFTAVLLAQ−−−H−−−−−−−−−−−−−−−−−−−−−GVTLRNI−−−−−DDVQLISYVLDAGRG−−SHGLDALS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ESN−−−LGHTLHVLGALTGSG−−−KAKIAFDQVPI−−−−−−−−−−−−−−−−−−−−−DRATEYGGERSDVALRLWRVLKP−−−RLVAERMMAVYETLERPLVGVLARMERRGISIDRQVLSRLSADFAQTAARIEAEIRE−−−−−−−−−−LA−−GEDINIGSPKQLGDILFGKMGLPGG−−−SKTKTGAWSTSAQVL−−DELA−−−EQGHEFPRKILDWRQVSKLRSTYTDALPTYVHPQTQRVHTTYALAATTTGRLSSNEPNLQNIPVR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TEDGRKIRRAFVATP−−−−−−−−−−−−−−−−−−−−GHRLVSADYSQIELRLLSEVADVPALRKAFQD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GIDIHAMTASEMFGVPVEGMP−−−−S−−−−−DIRRRAKAINFGIIYGISAFGL−−−−ANQL−−−−−GIPREEAG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AYIKRYFERFPGIRAYMDETRDFCRTH−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GYVETLFGRKCHYPD−−−−−−−−−−−−−−−−−−−−−−−−−−I−−−−−−KASNPSIR−−−−−−−−−−−−−−−−−−−−−−AFNERAAINARLQGSAADIIRRAMVRMEDALAEKKLAAQMLLQVHDELIFEVPEDEVTATLPVVSHVMQDAP                     
fig|439495.5.peg.3072   Pseudovibrio sp. JE062                                                                                   LED−−PAVLKIAQNMKYDWLVLKR−−−Y−−−−−−−−−−−−−−−−−−−−−GVEMAPF−−−−−DDTMLLSYALDAGMG−−GNGMDELS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QRW−−−LNHTPIPFKEVCGSG−−−KSQISFDKVPL−−−−−−−−−−−−−−−−−−−−−DKATAYAAEDADVTLRLWKILKP−−−RLAAEEMTVVYERLERPMVATLAKMERRGISIDRQMLSLLSGEFAQGAARLESEIHD−−−−−−−−−−VA−−GEIFNVGSPKQLGEILFGKMGLPGG−−−KKTKTGAWSTSASVL−−DDLA−−−AQGHELPSKIVEWRQLSKLKSTYTDALPSFINQETGRVHTSFSLASTSTGRLSSSEPNIQNIPIR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TSEGRKIRQAFIAEK−−−−−−−−−−−−−−−−−−−−GKKLISADYSQIELRVLAHMADIPQLKQAFAD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GLDIHAMTASEMFGVPIEGMD−−−−P−−−−−MVRRRAKAINFGIIYGISAFGL−−−−ANQL−−−−−GIARGEAG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DYIKTYFERFPGIKDYMEETKKFVHAN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GYVETIFGRRAHYPD−−−−−−−−−−−−−−−−−−−−−−−−−−V−−−−−−NTKNPNMR−−−−−−−−−−−−−−−−−−−−−−QFYERAAINAPIQGSAADIIRRAMVRMDEVLETANLDAQMLLQVHDELIFELPEDQVDETKKLVIATMEKATEPALQLSVP−−−−−−−−LKVE
fig|509190.6.peg.239   Caulobacter segnis ATCC 21756                                                                                   LED−−PAVLKVAQNAKYDIAVLAR−−−H−−−−−−−−−−−−−−−−−−−−−GIQVSPI−−−−−EDTMLISYVLEAGLH−−GHGMDELS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ELW−−−LGHKPIPFKQVAGTG−−−KAQISFKHVAL−−−−−−−−−−−−−−−−−−−−−SEATAYAAEDADVTLRLYETLKP−−−RLAREGLLTVYETLERPMPAVLAAMENDGIKVDPEALRRLSNEFSLRMAEFEARATE−−−−−−−−−−LV−−GRPFNLGSPKQIGDVLFGEMQIKGG−−−KKTATGQWSTDSDVL−−ESLA−−−LEHELPRVLLDWRQLSKLKGTYTENLVAAIAERTGRVHTSYALAATTTGRLSSSDPNLQNIPVR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TEEGRKIRKAFIAPQ−−−−−−−−−−−−−−−−−−−−GKVLISADYSQIELRLLAHIGDIPQLKRAFQE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GLDIHAMTASEMFDTPIEGMD−−−−P−−−−−MIRRRAKAINFGIVYGISAFGL−−−−ANQL−−−−−GIPQGEAG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AYIKTYFERFPGIQAYMDATKAFVREH−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GYVTTIFGRKINIPE−−−−−−−−−−−−−−−−−−−−−−−−−−I−−−−−−QAKSVGQR−−−−−−−−−−−−−−−−−−−−−−QFAERAAINAPIQGAAADVMRRAMIRMPEALQAAGLSARMLLQVHDELV                                             
fig|366602.3.peg.597   Caulobacter sp. K31                                                                     EEVIA−−−−ALKPLLED−−PAVLKIAQNAKYDIAVLAR−−−Y−−−−−−−−−−−−−−−−−−−−−GINVGPI−−−−−EDTMLISYVLEAGLH−−GHGMDELS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ELW−−−LGHKPISFKQVAGSG−−−KGQISFKHVGL−−−−−−−−−−−−−−−−−−−−−AEATAYAAEDADVTLRLYNVLKP−−−RLAREGLLTVYETLERPLPAVLAAMENDGIRVDPDTLRRLSNEFSMRMADFEARAQE−−−−−−−−−−LV−−GRPFNLGSPKQIGDVLFGEMALKGG−−−KKTATGQWSTDSDVL−−EALA−−−LEHELPRVLLDWRQLSKLKGTYTENLIAAIAPGGGNRVHTSYALAATTTGRLSSSDPNLQNIPIR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TEEGRKIRKAFVAAP−−−−−−−−−−−−−−−−−−−−GKVLISADYSQIELRLLAHIGDIPQLKKAFQE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GLDIHAMTASEMFNVPIEGMP−−−−S−−−−−EVRRRAKAINFGIVYGISAFGL−−−−ANQL−−−−−SIPQGEAG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AYIKTYFERFPGIQAYMEATKAFVREH−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GYVTTIFGRKINIPD−−−−−−−−−−−−−−−−−−−−−−−−−−I−−−−−−GGKSVAHR−−−−−−−−−−−−−−−−−−−−−−QFAERAAINAPIQGAAADVMRRAMVRMPGALKAAGLSSRMLLQVHDELVFEAPEAEAQATI                                
fig|366602.8.peg.603   Caulobacter sp. K31                                                                     EEVIA−−−−ALKPLLED−−PAVLKIAQNAKYDIAVLAR−−−Y−−−−−−−−−−−−−−−−−−−−−GINVGPI−−−−−EDTMLISYVLEAGLH−−GHGMDELS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ELW−−−LGHKPISFKQVAGSG−−−KGQISFKHVGL−−−−−−−−−−−−−−−−−−−−−AEATAYAAEDADVTLRLYNVLKP−−−RLAREGLLTVYETLERPLPAVLAAMENDGIRVDPDTLRRLSNEFSMRMADFEARAQE−−−−−−−−−−LV−−GRPFNLGSPKQIGDVLFGEMALKGG−−−KKTATGQWSTDSDVL−−EALA−−−LEHELPRVLLDWRQLSKLKGTYTENLIAAIAPGGGNRVHTSYALAATTTGRLSSSDPNLQNIPIR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TEEGRKIRKAFVAAP−−−−−−−−−−−−−−−−−−−−GKVLISADYSQIELRLLAHIGDIPQLKKAFQE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GLDIHAMTASEMFNVPIEGMP−−−−S−−−−−EVRRRAKAINFGIVYGISAFGL−−−−ANQL−−−−−SIPQGEAG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AYIKTYFERFPGIQAYMEATKAFVREH−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GYVTTIFGRKINIPD−−−−−−−−−−−−−−−−−−−−−−−−−−I−−−−−−GGKSVAHR−−−−−−−−−−−−−−−−−−−−−−QFAERAAINAPIQGAAADVMRRAMVRMPGALKAAGLSSRMLLQVHDELVFEAPEAEAQATI                                
fig|402881.8.peg.111   Parvibaculum lavamentivorans DS-1                                                                                   LED−−PSILKIGQNLKFDMTVLRQ−−−H−−−−−−−−−−−−−−−−−−−−−GIQLKGL−−−−−DDTMLMSYALDAGVH−−GHGMDELS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ELH−−−LGHKPISFAEVAGKG−−−KAQITFDQVPV−−−−−−−−−−−−−−−−−−−−−DRATAYAAEDADVTLRLWHILKP−−−RLVAERRVTVYETLERPLVSVLAEMERAGVKVDKAVLARLSGDFSQKMAQYEDEIYE−−−−−−−−−−LA−−GERFNIGSPKQLGEILFDKQSLEGG−−−RKTKTGAWSTDADTL−−EALA−−−AKGHELPQRVLDWRGLSKLKSTYTDALPEYINPETGRIHTCYSLASTSTGRLASTEPNLQNIPVR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TEDGRKIRTAFVAEK−−−−−−−−−−−−−−−−−−−−GNLLISADYSQIELRLLAHIADIEALKKAFAE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GLDIHAMTASEMFGVPIEGME−−−−S−−−−−SVRRRAKAINFGIIYGISAFGL−−−−ANQL−−−−−GIPRQEAG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EYIDRYFKRFPGIRAYMDDTRDFAHKN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GYVETIFGRRIHLPA−−−−−−−−−−−−−−−−−−−−−−−−−−I−−−−−−NSKNPAEK−−−−−−−−−−−−−−−−−−−−−−SFMERAAINAPIQGSAADIIRRAMIRMPQALADAKLAARMLLQVHDELIFEVPEKEAEKTSKVVSRIMSDAAAPAVALTVP−−−−−−−−LDVD
fig|314260.5.peg.873   Parvularcula bermudensis HTCC2503                                                                                   LLD−−PSILKVGQNLKYDLLILRE−−−R−−−−−−−−−−−−−−−−−−−−−DIDVVGY−−−−−DDTMLLSYAADCGFA−−SLHGMDELS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KRH−−−LGHEPIPYKEIVGTG−−−KKQKTFGDVPI−−−−−−−−−−−−−−−−−−−−−KDAYIYAAEDADVTLRLHTILKS−−−RAIESQVYTVYETMDRPLVSVITDMERAGIKVDRDRLSALSGEFAQRMAAHEAAVHD−−−−−−−−−−IA−−GERFNLASPKQIGDILFGKLGLPGG−−−KKTKTGAWSTAADTL−−ETLA−−−ADGAEIAQEILSHRGLAKLKGTYTDALSESIHPKTGRVHTSFSLASTTTGRLSSNDPNLQNIPIR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TEDGRKIREAFIPED−−−−−−−−−−−−−−−−−−−−GNVLISADYSQIELRLLAHIAEIGPLIEAFHQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GLDIHAMTAAEVFGVPLEGMD−−−−P−−−−−SIRRQAKAINFGIIYGISAFGL−−−−ARNL−−−−−GIGRDEAS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LFIKRYFERFPGIKAYMDETIEGARVH−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GYVETLFGRRSHTPN−−−−−−−−−−−−−−−−−−−−−−−−−−I−−−−−−KAKQPNIR−−−−−−−−−−−−−−−−−−−−−−MGAERQAINAPIQGSAADIVKRAMIRVPAALAAHRLSAKMLLQVHDELVVECPADQADET                                 
fig|622759.3.peg.1083   Zymomonas mobilis subsp. mobilis NCIMB 11163                                                                                   LED−−PSILKIGQNIKYDMIVLSR−−−Y−−−−−−−−−−−−−−−−−−−−−GISVQPF−−−−−DDTMLLSYDLDAGRH−−GHGMDELS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LLY−−−FDHQPISFKSVCGTG−−−KSAITFNHVPI−−−−−−−−−−−−−−−−−−−−−PAATRYAAEDADITFRLWALLKP−−−RLSSDGATRIYEEVDRPLPPVIARMEQAGITVDSVALHHLSSRFAHDISRLEEEIYV−−−−−−−−−−LA−−GCRFLISSPKQLGEVLFGTMGLAGG−−−KKSKSGQYSTNVTEL−−ERLA−−−AEGEVIASKILEWRQLSKLKSTYSDALIGKVNPETGRVHTSFSLVGAQTGRLSSTDPNLQNIPIR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TEIGREIRNAFIAKK−−−−−−−−−−−−−−−−−−−−GHLLLSADYSQIELRLAAHVADEKALLQAFQE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KEDIHALTAKQLFG−−−−−HVD−−−−R−−−−−ESRARAKTINFAILYGISAWGL−−−−AARL−−−−−EIDRFSAQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EMIDRYFERFPAIRHYIDRTLDFVRLH−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GYVETPFGRKTHLPA−−−−−−−−−−−−−−−−−−−−−−−−−−I−−−−−−KSRKVTER−−−−−−−−−−−−−−−−−−−−−−QAAERQAINAPIQGMSADIIKRAMVRMEPALAKAGLSSVKMLLQVHDELIFEVPEED                                     
fig|555217.8.peg.714   Zymomonas mobilis subsp. mobilis ATCC 10988                                                                                    ED−−PSILKIGQNIKYDMIVLSR−−−Y−−−−−−−−−−−−−−−−−−−−−GISVQPF−−−−−DDTMLLSYDLDAGRH−−GHGMDELS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LLY−−−FDHQPISFKSVCGTG−−−KSAITFNHVPI−−−−−−−−−−−−−−−−−−−−−PAATRYAAEDADITFRLWALLKP−−−RLSSDGATRIYEEVDRPLPPVIARMEQAGITVDSVALHHLSSRFAHDISRLEEEIYA−−−−−−−−−−LA−−GCRFLISSPKQLGEVLFGTMGLAGG−−−KKSKSGQYSTNVTEL−−ERLA−−−AEGEVIASKILEWRQLSKLKSTYSDALIGKINPETGRVHTSFSLVGAQTGRLSSTDPNLQNIPIR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TEIGREIRNAFIAKK−−−−−−−−−−−−−−−−−−−−GHLLLSADYSQIELRLAAHVADEKALLQAFQE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KEDIHALTAKQLFG−−−−−HVD−−−−R−−−−−ESRARAKTINFAILYGISAWGL−−−−AARL−−−−−EIDRFSAQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EMIDRYFERFPAIRHYIDRTLDFVRLH−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GYVETPFGRKTHLPA−−−−−−−−−−−−−−−−−−−−−−−−−−I−−−−−−KSRKVTER−−−−−−−−−−−−−−−−−−−−−−QAAERQAINAPIQGMSADIIKRAMVRMEPALAKVGLSSVKMLLQVHDELIFEVPEED                                     
fig|452662.3.peg.3119   Sphingobium japonicum UT26S                                                              KPDQLPLPLVLA−−−−KLKPLLED−−DSVLKIGQNLKYDITVLRR−−−H−−−−−−−−−−−−−−−−−−−−−GIEIAPY−−−−−DDTIVMSFDLDAGQSLAGHGMDEAA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RVH−−−LNHVCISFKDVCGTG−−−RSQISFAEVPL−−−−−−−−−−−−−−−−−−−−−DKATEYAAEDADVTLRLWRLFKS−−−RIANEGATRVYELVDRPLVGVIAKMEHEGIKVDREALSRLSAEFTAGIAALEGEIHA−−−−−−−−−−LA−−GQPFAIGSTQQLGAILFDKMGYKGG−−−RKGKSGAYSTDVTIL−−EQLK−−−AQGAEIAGKVLDWRQLSKLKSTYTDALQAQINKDSGRVHTSYSLSGAQTGRLSSTDPNLQNIPIR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TEVGRQIRHAFVAEP−−−−−−−−−−−−−−−−−−−−GNVILAADYSQIELRLAAHMADVPALKEAFAN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GEDIHAATAQQLFG−−−−−EVN−−−−R−−−−−DTRGRAKTINFAILYGISRWGL−−−−AGRL−−−−−EISADEAQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DMISRYYERFPGISLYITDTIEKARSR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GYTETLFGRKTWFPR−−−−−−−−−−−−−−−−−−−−−−−−−−I−−−−−−KAPVQHER−−−−−−−−−−−−−−−−−−−−−−QGAERAAINAPIQGTSADIIKRAMARMGPALAAEGLHRVKMLLQVHDELVFELPEGD                                     
fig|314271.5.peg.1167   Rhodobacterales bacterium HTCC2654                                              GHKVGDGEGLFADDKLAEGQLSLDDVLA−−−−ALKPVLED−−PAILKIFQNAKYDTKIFSR−−−H−−−−−−−−−−−−−−−−−−−−−GLNVAPI−−−−−DDTMLMSYAMFSGLH−−NHGMDTLS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EHY−−−LGHTPISIKTLLGTG−−−KSAITFDKVKI−−−−−−−−−−−−−−−−−−−−−EDAVKYAAEDADVTLRLWQLFKP−−−RLHREKVTTVYETLERPLVPVLAQMEMHGVQVDRDTLSRMSNAFAQKMAGLEAEIHE−−−−−−−−−−LA−−GQSFNVGSPKQLGEILFDKLGLEGG−−−KKGKTGAYATGADVL−−EDLA−−−AQHDLPARVLDWRQLSKLKSTYTDALQTHIDPDTGRVHTSYLQTGASTGRLASTDPNLQNIPIR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TEEGRRIREAFVAPE−−−−−−−−−−−−−−−−−−−−GKVLVSLDYSQIELRILAHVAGIESMKQAFRD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GEDIHAATASEMFDVPLDEMT−−−−P−−−−−DVRRQAKAINFGVIYGISGFGL−−−−ARNL−−−−−RIARGEAQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GFIDRYFEKYPGIKEYMDDTVAFAKEH−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GHVATLFGRKIHTPE−−−−−−−−−−−−−−−−−−−−−−−−−−I−−−−−−NAKGPHA−−−−−−−−−−−−−−−−−−−−−−−GFARRAAINAPIQGSAADIIRRAMIRMPDAIS−−GLPVKMLLQVHDELIFEVEEGGVDKAVSVI                             
fig|318586.5.peg.1787   Paracoccus denitrificans PD1222                                                                                   LED−−PSVLKIGQNIKYDWKVLAR−−−H−−−−−−−−−−−−−−−−−−−−−GIRMVPL−−−−−DDTMLLSYAQNAGAH−−NHGMDELA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DLY−−−LGHRCLPIKDLIGSG−−−KSQINFSQVAI−−−−−−−−−−−−−−−−−−−−−DKASEYAAEDAEVTWRLWRHLRP−−−KLAPNHVTTAYERLERPMIAVLADMEMAGIRIDSEHLKRMSNAFAQKMAGLEAEIHE−−−−−−−−−−LA−−GGPFNVGSPKQLGEILFERMGLAGG−−−KQGKTGAFSTGAEVL−−EDLA−−−AEGHELPARVLDWRAISKLKSTYTDALPLHVNPETGRVHTSYSIAGAQTGRLASTDPNLQNIPVR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TDEGRRIREAFVAAP−−−−−−−−−−−−−−−−−−−−GMRLVSLDYSQIELRILAHVAQIPALQQAFRD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GIDIHAMTASQMFGVPVEGMD−−−−P−−−−−MIRRRAKAINFGVIYGISGFGL−−−−ARNL−−−−−RIPRAEAQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AFIDTYFERFPEIRAYMDRTVAGAKQD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GFVRTLFGRRIMTPG−−−−−−−−−−−−−−−−−−−−−−−−−−I−−−−−−NQSGPAA−−−−−−−−−−−−−−−−−−−−−−−GGARRAAINAPIQGAAADIIRRAMIRMPQAIA−−HLPARMLLQVHDELVFEVEEAAVPELVEV                              
fig|318586.4.peg.1735   Paracoccus denitrificans PD1222                                                                                   LED−−PSVLKIGQNIKYDWKVLAR−−−H−−−−−−−−−−−−−−−−−−−−−GIRMVPL−−−−−DDTMLLSYAQNAGAH−−NHGMDELA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DLY−−−LGHRCLPIKDLIGSG−−−KSQINFSQVAI−−−−−−−−−−−−−−−−−−−−−DKASEYAAEDAEVTWRLWRHLRP−−−KLAPNHVTTAYERLERPMIAVLADMEMAGIRIDSEHLKRMSNAFAQKMAGLEAEIHE−−−−−−−−−−LA−−GGPFNVGSPKQLGEILFERMGLAGG−−−KQGKTGAFSTGAEVL−−EDLA−−−AEGHELPARVLDWRAISKLKSTYTDALPLHVNPETGRVHTSYSIAGAQTGRLASTDPNLQNIPVR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TDEGRRIREAFVAAP−−−−−−−−−−−−−−−−−−−−GMRLVSLDYSQIELRILAHVAQIPALQQAFRD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GIDIHAMTASQMFGVPVEGMD−−−−P−−−−−MIRRRAKAINFGVIYGISGFGL−−−−ARNL−−−−−RIPRAEAQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AFIDTYFERFPEIRAYMDRTVAGAKQD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GFVRTLFGRRIMTPG−−−−−−−−−−−−−−−−−−−−−−−−−−I−−−−−−NQSGPAA−−−−−−−−−−−−−−−−−−−−−−−GGARRAAINAPIQGAAADIIRRAMIRMPQAIA−−HLPARMLLQVHDELVFEVEEAAVPELVEV                              
fig|349163.4.peg.1979   Acidiphilium cryptum JF-5                                                              DGPQLPRPLALE−−−−RLAPVLAD−−PSILKIFHNAKFDLHVLER−−−A−−−−−−−−−−−−−−−−−−−−−GLADATPV−−−−−DDTMLMSYTLGAGRH−−GHGMDELS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ALH−−−LDHRPISYDEVTGTG−−−RSRVSFAAVPI−−−−−−−−−−−−−−−−−−−−−DRATAYAAEDADVTLRLWLLLRP−−−RLRTEAALALYETMERRLLSVLLGMERAGIMVDRADLESMSAEFARRMDDIQREIEK−−−−−−−−−−LA−−GRAFNPGSPKQLGEILFDEMGLPGG−−−KRTKTGAWGTDATVL−−EELA−−−ASGHDLPVRVLEWRQLQKLKSTYADALVGEIDIADQRVHTSFSQAITTTGRLSSNEPNLQNIPIR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TSEGARIRRAFIAAP−−−−−−−−−−−−−−−−−−−−GKALISADYSQIELRLLAHVADIPALKESFAK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GEDIHARTAAEVFGLPMEGMD−−−−P−−−−−MVRRRAKAINFGIIYGISAFGL−−−−ARQL−−−−−GIENSEAK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RFIDAYFARYPEIRRYMNETAEFARTH−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GYVLTPFGRRCYVPG−−−−−−−−−−−−−−−−−−−−−−−−−−I−−−−−−TEKNPARR−−−−−−−−−−−−−−−−−−−−−−GYAERQAINAPLQGGAADIIKRAMVRLPAAIRDAGLDAVMLLQVHDELVFEAPKDQAEATAKLACAVM                         
fig|331869.3.peg.473   alpha proteobacterium BAL199                                                                               LKDLLEN−−PAVLKIAHNAKYDALVLSRPKNG−−−−−−−−−−−−−−−−−−−−−GITVAPI−−−−−DDTMCLSYVLEGGLH−−GHGLDELA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TLH−−−LGHTNIKFEEVCGKG−−−KTQIGFAEAPI−−−−−−−−−−−−−−−−−−−−−DKACAYAAEDADVTFRLHALLKP−−−RLVPERMTTVYETLERALIPVLVGMERNGIKVDPTILRDMSADFAKRLVTLEGEIHE−−−−−−−−−−QA−−GEPFNVGSPKQLGEILFDKMGLAGG−−−KKGKTGAYGTGADVL−−ETLA−−−AEGSDFARKVLDWRQIAKLKSTYTDALVETINAETGRVHTSYSMVGAATGRLSSNDPNLQNIPIR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TEEGRKIRTAFVAEP−−−−−−−−−−−−−−−−−−−−GNVLLSVDYSQIELRLVADIAGIESLRKAFLD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GIDIHAQTASEVFGVPLSEMT−−−−P−−−−−DIRRKAKAINFGIIYGISGFGL−−−−ARQL−−−−−STSQAEAQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AYINAYFERFPGIRDYMTEMKTFAREH−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GFVETKFGRKVHIQA−−−−−−−−−−−−−−−−−−−−−−−−−−I−−−−−−RDKNPAMR−−−−−−−−−−−−−−−−−−−−−−NFGERAAINAPIQGTAADVIKRAMVRLPVALDKAQSKARMLLQVHDELLFEVPEDDVEATSALVREVMEGAAAPQLNLSVP−−−−−−−−LIAE
fig|638315.3.peg.1969   Legionella longbeachae D-4968          IDTETTSL−−−−−−−−−−−−−−DVMMAEIVGISLAIEEGKAAYIPLTHDD−−GSPQLLREEVLT−−−−ALNPILEN−−PTIKKIGQNLKYDYSVLRN−−−H−−−−−−−−−−−−−−−−−−−−−GITLKGI−−−−YYDTMLESYVLNSGSG−−RHDMDSLA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LKY−−−LGHKTISYEEIAGKG−−−AKQLRFDQIPV−−−−−−−−−−−−−−−−−−−−−EKAGAYAAEDADITLQLHHKLYP−−−LIPE−−SVHHVFGNIEMPLVTVLADMERMGVLIDSATLKQHGERLKERIRTLEEEALH−−−−−−−−−−LA−−GKPFNLNSPKQLQEILFDSHKLPII−−−AKTPTGQPSTAEAVL−−QELA−−−YDYRLAAVILEYRSLTKLVSTYIDALPKKINPKTNRVHTSYNQAVTATGRLSSSEPNLQNIPIR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SEEGRLIRTAFIAPE−−−−−−−−−−−−−−−−−−−−DNIILAADYSQIELRIMAHLSQDENLLKAFAN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GWDVHAATASEIFQIPLEEIN−−−−N−−−−−EQRRRAKAINFGLIYGMSSFGL−−−−AKQI−−−−−GVERQDAQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YYIDTYFQRYPKVLEYMNRTRQQAHHQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GYVETLFGRRLYLPE−−−−−−−−−−−−−−−−−−−−−−−−−−I−−−−−−NARNLMRQ−−−−−−−−−−−−−−−−−−−−−−KAAERTAINAPMQGTAADIIKNAMICIAKWQNSHEKPPARMIMQVHDELVFEVNKNAIESSKEMIRELMEHTVT                    
fig|269799.8.peg.3015   Geobacter metallireducens GS-15       TFAVDLETTSL−−−−−−−−−−−−−−NPLEAEIVGISLSYRDHEACYIPVGHFYLGAPEQLPRRRVLD−−−−ALTPLLID−−PKIRKVGQNLKYDYQVFRR−−−H−−−−−−−−−−−−−−−−−−−−−GIELGGV−−−−WCDTMVASYLLNPVRS−−GHGLDSLA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VEH−−−LDHKMISYEEVAGKG−−−KEQVNFAQVPV−−−−−−−−−−−−−−−−−−−−−EKASTYSCEDSDAAWLLHRLFLP−−−RVAVWGMERLFFDVEMPLVPILAEMELAGVKLDLPLLGELSAGFGKQLAELEGRITG−−−−−−−−−−LA−−PEPFNLNSPKQLGEVLFEKLKLPTGKKTKTKTGWSTNVEEL−−ERLA−−−EAGHEIAALILQYRGLAKLKSTYTDALPKLVQPATGRVHTSYNQTVTNTGRLSSSEPNLQNIPVR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TEEGRRIRRAFIAEE−−−−−−−−−−−−−−−−−−−−GHLLLSADYSQIELRVLAHFSEDRVFCDAFAK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DEDIHTRTAAEVFGLFPEMVT−−−−P−−−−−EMRRQAKAINFGVIYGQGAFSL−−−−AKQL−−−−−GIATKVAR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EFIDNYFARHPGARAFLDGCVREAEEK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GHVTTLLGRRLPIPD−−−−−−−−−−−−−−−−−−−−−−−−−−I−−−−−−KSANGNIR−−−−−−−−−−−−−−−−−−−−−−AFAQRNAVNYPIQGSAADIIKEAMVKVTARMRRDVVGSRLIMQVHDELVFEVPKGEVVAMEQLVRREMEHAVSLRVPLKVD            
fig|243231.1.peg.537   Geobacter sulfurreducens PCA         SVDLETTSL−−−−−−−−−−−−−−NPLEADIVGISLSFRDHEACYIPVGHAYDGAPAQLDRTLVLE−−−−GLRPLLTD−−PAVRKVGQNLKYDYQVLRR−−−H−−−−−−−−−−−−−−−−−−−−−GIVMAGV−−−−WCDTMVASYLINPVRS−−GHGLDSLA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VEH−−−LDHRMISYEEVAGKG−−−KDQLNFARVPV−−−−−−−−−−−−−−−−−−−−−EKASTYSCEDADAAWLLHRLFLP−−−RVAEAGMERLFFDLEMPLVPILAEMETAGVKLDLALLGELSAGLGSQLTALEEQVMA−−−−−−−−−−LA−−PEPFNLNSPKQLGEVLFEKMKLPAGKKTKTKTGWSTNVEEL−−ERLA−−−EAGHEIAAAILRYRGLAKLKSTYTDALPRLVHPASGRVHTSYNQTVTNTGRLSSSEPNLQNIPVR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TDEGRKIRRAFIAEE−−−−−−−−−−−−−−−−−−−−GHLILSADYSQIELRVLAHLSEDRVFCDAFAR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DEDIHTRTAAEVFGLFPEMVT−−−−P−−−−−EMRRQAKAINFGVIYGQGAFSL−−−−AKQL−−−−−GITTKVAK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EFIDNYFARHPGARAFLDGCVAEAEAR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GYVTTLMGRRLPIPD−−−−−−−−−−−−−−−−−−−−−−−−−−I−−−−−−ASSNGNIR−−−−−−−−−−−−−−−−−−−−−−AFAQRNAVNYPIQGSAADIIKAAMVRVTERMRREGLTSRLIMQVHDELVFEVPEGERTAMERLVQHEMEHAAPLRVPLRAD            
fig|177439.6.peg.1167   Desulfotalea psychrophila LSv54                                                                                   LTC−−ADILKVGHNLKYDWTVLKM−−−QT−−−−−−−−−−−−−−−−−−−−GVEIFPL−−−−−ADTMVAAHLLEKGRT−−−−LKLDDLC−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AE−−−−IGLELTSFAEVVAED−−−KRADAFAYVAL−−−−−−−−−−−−−−−−−−−−−KEACHYSCEDVYGALSLWQDFGE−−−KLSDKALDGLFYDVEMPIIPVLAKMEIGGVCLDSTVLVELAAQFEEQIG