(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00010943

fig|521095.5.peg.1081   Atopobium parvulum DSM 20469                                                                                                GRSPLIVSEAG−−LYNLVLRSRK−−−−−−−−−−−−−−−−−−−−−−−−−−−PEAKPFRR−−−−WVTH−−−−−EVLPS−−IRRSGGYIATDGSESN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EDLLARAVLVANEAIQRKDAQLKEQQRQ−−−−LYEK−−DTTIIEQGAK−−−−−−−I−−−−DELAPKAGMYDTVINVKGTMTITDAARYLSQYDP−−−−−−−−−−−−−−−QITRKRLFALLRADGLICRVGK−−−−−−−−−−−−APTK−−KGIETGRFVQIMS−−−−−−TRRDGKS−−−NEPYARMTQKG                  
fig|391904.5.peg.1137   Bifidobacterium longum subsp. infantis ATCC 15697                                                                                           KPWATVVIMPMVGADGKNREMAMIDRRTMTMWLANINPGKVKPELRSKIEAYQCEAADALDK−−−−YFNEGAAI−−RFKT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NSMDDESL−−−I−−−−−−L−−AKANQIQSRLLG−−−−−−EA−−RRENLELRAS−−−−−−−N−−−−EKMRPLALLGEAFVSADGTMSVRQAARHFQAIDK−−−−−−−−−−−−−−RMNCDTVYGILRGAGYIELRSK−−−−−−−−−−−−APTV−−KAVKPGYLKPVMS−−−−−−RKANGKLD−−−RQCARFTAKGVNWFIDRF          
fig|391904.8.peg.1165   Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222                                                                                           KPWATVVIMPMVGADGKNREMAMIDRRTMTMWLANINPGKVKPELRSKIEAYQCEAADALDK−−−−YFNEGAAI−−RFKT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NSMDDESL−−−I−−−−−−L−−AKANQIQSRLLG−−−−−−EA−−RRENLELRAS−−−−−−−N−−−−EKMRPLALLGEAFVSADGTMSVRQAARHFQAIDK−−−−−−−−−−−−−−RMNCDTVYGILRGAGYIELRSK−−−−−−−−−−−−APTV−−KAVKPGYLKPVMS−−−−−−RKANGKLD−−−RQCARFTAKGVNWFIDRF          
fig|382640.5.peg.354   Bartonella tribocorum CIP 105476              LHAFL−−−−−−−−−−−−−−EIKARFNDWIKNRIKEYKFQENINF−−−−−I−−−TLTKN−−−−−−−−−−−LVNGGKVKEY−−−−−−−HITLDM−−AKHLSMIERN−−−−−−−−−−−−−−−−−−−−−−−−−−−DKGHEARQ−−−−YFIK−−−−−−−−−−−−−−−−−−−−−−−−CERLLKQVAT−−−−−PQVDYS−−−−K−−−−−−−−PEA−−−L−−−−−−L−−GVLNHLQSQIEQ−−−−−−−−−−−−−−−−KDHA−−−−−−−I−−−−AELTPKAEALEGLKRSDGLFGLIEAAKML−−−−−−−−−−−−−−−−−−−−−EVRPKDLTDYLRKHDWVYRRAPGAPL−−−−−−−−LPYQ−−DKIKKGFMDCPAITIQ−−RPDGTEK−−VLPSTKITSRG                  
fig|382640.5.peg.530   Bartonella tribocorum CIP 105476              LHAFL−−−−−−−−−−−−−−EIKARFNDWIKNRIKEYKFQENINF−−−−−I−−−TLTKN−−−−−−−−−−−LVNGGKVKEY−−−−−−−HITLDM−−AKHLSMIERN−−−−−−−−−−−−−−−−−−−−−−−−−−−DKGHEARQ−−−−YFIK−−−−−−−−−−−−−−−−−−−−−−−−CERLLKQVAT−−−−−PQVDYS−−−−K−−−−−−−−PEA−−−L−−−−−−L−−GVLNHLQSQIEQ−−−−−−−−−−−−−−−−KDHA−−−−−−−I−−−−AELTPKAEALEGLKRSDGLFGLIEAAKML−−−−−−−−−−−−−−−−−−−−−EVRPKDLTDYLRKHDWVYRRAPGAPL−−−−−−−−LPYQ−−DKIKKGFMDCPAITIQ−−RPDGTEK−−VLPSTKITSRG                  
fig|283166.1.peg.274   Bartonella henselae str. Houston-1              LHAFL−−−−−−−−−−−−−−EIKSEFRNWIKNRIKECKFQENINF−−−−−VTAVNF−−−−−−−−−−−−−−−−YRGGKVKEY−−−−−−−HITLDM−−AKHLSMIERN−−−−−−−−−−−−−−−−−−−−−−−−−−−EKGHEARQ−−−−YFIK−−−−−−−−−−−−−−−−−−−−−−−−CERLLKQVAT−−−−−PQVDYS−−−−K−−−−−−−−PEA−−−L−−−−−−L−−GVLNHLQSQIEQ−−−−−−−−−−−−−−−−KDNT−−−−−−−I−−−−AELTPKAEALEGLKRSDGLFGLIEAAKML−−−−−−−−−−−−−−−−−−−−−EVRPKDLTDYFYKN                                                                                    
fig|634504.3.peg.930   Bartonella grahamii as4aup              LHTFL−−−−−−−−−−−−−−EIKARFNDWIKNRIKECKFLENINF−−−−−I−−−TLTKN−−−−−−−−−−−LVSGGKVKEY−−−−−−−HITLDM−−AKHLSMIERN−−−−−−−−−−−−−−−−−−−−−−−−−−−DKGHEARQ−−−−YFIK−−−−−−−−−−−−−−−−−−−−−−−−CERLLKQVAT−−−−−PQVDYS−−−−K−−−−−−−−PEA−−−L−−−−−−L−−GVLNHLQSQIEQ−−−−−−−−−−−−−−−−KDHV−−−−−−−I−−−−AELAPKAKALDGLKRSDGLFGLIEAAKML−−−−−−−−−−−−−−−−−−−−−EVRPKDLTDYLRKHDWVYRRAPGAPL−−−−−−−−LPYQ−−DKIKKGFMDCPAITIQ−−RPDGTEK−−LLPSTKITSRG                  
fig|283166.1.peg.273   Bartonella henselae str. Houston-1              LHAFL−−−−−−−−−−−−−−EIKARFNDWIKNRIKECKFQENINF−−−−−I−−−TLTKN−−−−−−−−−−−LVNGGKVKEY−−−−−−−HITLDM−−AKHLSMIERN−−−−−−−−−−−−−−−−−−−−−−−−−−−DKGHEARQ−−−−YFIK−−−−−−−−−−−−−−−−−−−−−−−−CERLLKQVAT−−−−−PQVDYS−−−−K−−−−−−−−PEA−−−L−−−−−−L−−GVLNHLQSQIEQ−−−−−−−−−−−−−−−−KDHV−−−−−−−I−−−−AELAPKAEALEGLKRSDGLFGLIEAAKML−−−−−−−−−−−−−−−−−−−−−EVRPKDLTDYLRKHDWVYRRAPSGPL−−−−−−−−LPYQ−−DKIKKGFMDCPAITIQ−−RPDGTEK−−VLPSTKITPKG                  
fig|634504.3.peg.368   Bartonella grahamii as4aup              LHAFL−−−−−−−−−−−−−−EAKRDFSNWIKDRIIKYNLEEGIDY−−−−−IL−−TLAKT−−−−−−−−−−−GERQNVVLKEY−−−−−−−YLTLNV−−AKELSMLENN−−−−−−−−−−−−−−−−−−−−−−−−−−−KKGREARL−−−−YFIK−−−−−−−−−−−−−−−−−−−−−−−−CERLLKQVTT−−−−−PQVDYS−−−−K−−−−−−−−PEA−−−L−−−−−−L−−GVLNHLQSQIEQ−−−−−−−−−−−−−−−−KDHV−−−−−−−I−−−−AELAPKAKALDGLKRSDGLFGLIEAAKML−−−−−−−−−−−−−−−−−−−−−EVRPKELTDYLRKHDWVYRRAPGAPL−−−−−−−−LPYQ−−DKIKKGFMDCPAITIQ−−RPDGTEK−−VLPSTKITPKG                  
fig|382640.5.peg.2319   Bartonella tribocorum CIP 105476                                                                                                                LILVSGY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−STALRA−−−−KIID−−−−−−−−−−−−−−−−−−−−−−−RWQELEKQVST−−−−−SQQIDYS−−−−S−−−−−−−−PQV−−−M−−−−−−L−−GVLTHLKNENER−−−−−−−−−−−−−−−−KDII−−−−−−−I−−−−AELKPKAIALDGLKRSDGLFGIIDAAKIL−−−−−−−−−−−−−−−−−−−−−EIRPKDLSDYLRRYGWVYKRVPSGPL−−−−−−−−LPYQ−−DKIQKGLMDCTAITIQ−−KNDGTEK−−TVPSTKITSKG                  
fig|283166.1.peg.316   Bartonella henselae str. Houston-1              LHTFL−−−−−−−−−−−−−−EVGKKFADWITERIHKYNLLENQDF−−−−−VCFPILGSK−−−−−−−−−−−−GRGGHNRKEY−−−−−−−HLTLSV−−AKELSMVENN−−−−−−−−−−−−−−−−−−−−−−−−−−−KKGREARL−−−−YFIE−−−−−−−−−−−−−−−−−−−−−−−−CERRLKQAATLQIETPQVDYS−−−−K−−−−−−−−PEA−−−L−−−−−−L−−GVLNHLQSQIEQ−−−−−−−−−−−−−−−−KDNT−−−−−−−I−−−−AELTPKAEALEGLKRSDGLFGLIEAAKML−−−−−−−−−−−−−−−−−−−−−EVRPKDLTDYLRRFAKFLFDNVLSVCL−−−−−−−−LSNQVPQKHLKSIADRLPTQSFF−−RA−−−−−−−−LKALTHYTLHAYNRFVGCSYAIQYPLWGK
fig|283166.1.peg.296   Bartonella henselae str. Houston-1              LHTFL−−−−−−−−−−−−−−EIGKDFSTWITDRINKYNLLENQDF−−−−−VCSPILGSK−−−−−−−−−−−GRGGHNRKDY−−−−−−−HLTLSV−−AKELSMLENN−−−−−−−−−−−−−−−−−−−−−−−−−−−KKGREARL−−−−YFIE−−−−−−−−−−−−−−−−−−−−−−−−CERRLKQVATPQIAPPQVDYS−−−−K−−−−−−−−PEA−−−L−−−−−−L−−GVLNHLQSQIEQ−−−−−−−−−−−−−−−−KDHV−−−−−−−I−−−−AELAPKAEALEGLKRSDGLFGLIEAAKML−−−−−−−−−−−−−−−−−−−−−EVRPKDLTDYLRKHDWVYRRAPGAPL−−−−−−−−LPYQ−−DKIKKGFMDCPAITIQ−−RPDGTEK−−VLPSTKITSRG                  
fig|634504.3.peg.388   Bartonella grahamii as4aup              LHGFL−−−−−−−−−−−−−−EIGKDFSTWITDRINKYNLLENQDF−−−−−VCSPILGSK−−−−−−−−−−−GRGGHNRKDY−−−−−−−HLTLSV−−AKELSMLENN−−−−−−−−−−−−−−−−−−−−−−−−−−−KKGREARL−−−−YFIK−−−−−−−−−−−−−−−−−−−−−−−−CERLLKQVVT−−−−−PQVDYS−−−−K−−−−−−−−PEA−−−L−−−−−−L−−GVLNHLQNQIEQ−−−−−−−−−−−−−−−−KDHV−−−−−−−I−−−−AELTPKAEALDGLKRSDGLFGLIEAAKIL−−−−−−−−−−−−−−−−−−−−−EVRPKDLTDYLRKHDWVYRRAPGAPL−−−−−−−−LPYQ−−DKIKKGFMDCPAITIQ−−RPDGTEK−−LLPSTKITSRG                  
fig|382640.5.peg.988   Bartonella tribocorum CIP 105476              LHAFL−−−−−−−−−−−−−−EIGKDFSTWITDRINKYNLVENQDF−−−−−VCSPILGSK−−−−−−−−−−−GRGGHNRKDY−−−−−−−HLTLSV−−AKELSMVENN−−−−−−−−−−−−−−−−−−−−−−−−−−−KKGREARL−−−−YFIE−−−−−−−−−−−−−−−−−−−−−−−−CERRLKQVAT−−−−−PQVDLANALEN−−−−−−−−PLT−−−I−−−−−−K−−QLLLESINQLED−−−−−−−−−−−−−−−−LRNE−−−−−−−V−−−−STLTPKAEALEGLKRSDRLFGLI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DYLRKHDWVYRRAPGAPL−−−−−−−−LPYQ−−DKIKKGFMNCPAITIQ−−RPDGTEK−−VLPSTKITSR                   
fig|382640.5.peg.510   Bartonella tribocorum CIP 105476               HAFL−−−−−−−−−−−−−−EVKRDFSNWIKDRINKYDFKEERDY−−−−−IL−−TLAKI−−−−−−−−−−−GERQNVVLKEY−−−−−−−HLTLSV−−AKELSMVENN−−−−−−−−−−−−−−−−−−−−−−−−−−−KKGREARL−−−−YFIE−−−−−−−−−−−−−−−−−−−−−−−−CEKRAKQVTT−−−−−PQVDLANALEN−−−−−−−−PLT−−−I−−−−−−K−−QLLLESINQLED−−−−−−−−−−−−−−−−LRNE−−−−−−−V−−−−STLKPKAEALEGLKRSDGLFGLIEAAKML−−−−−−−−−−−−−−−−−−−−−EVRPKDLTNYLRKHDWVYRRAPGAPL−−−−−−−−LPYQ−−DKIKKGFMDCPAITIQ−−RPDGTEK−−VLPSTKITSRG                  
fig|283166.1.peg.314   Bartonella henselae str. Houston-1              LHTFL−−−−−−−−−−−−−−EVGKDFSTWIKDRINKYNLLENQDY−−−−−LVFTNFGEN−−−−−−−−−−−LQGGRPSKDY−−−−−−−HLTLNV−−AKELSMVENN−−−−−−−−−−−−−−−−−−−−−−−−−−−KKGREARL−−−−YFIE−−−−−−−−−−−−−−−−−−−−−−−−CERRLKQAATLQIETPQVDYS−−−−K−−−−−−−−PEV−−−L−−−−−−R−−GVLNHLQSQIEQ−−−−−−−−−−−−−−−−KDHV−−−−−−−I−−−−AELAPKAEALEGLKRSDGLFGLIEAAKML−−−−−−−−−−−−−−−−−−−−−EVRPKDLTDYLRKHDWVYRRAPSGPL−−−−−−−−LPYQ−−DKIKKGFMDCPAITIQ−−RPDGTEK−−VLPSTKITPKG                  
fig|382640.5.peg.1022   Bartonella tribocorum CIP 105476              LHAFL−−−−−−−−−−−−−−EVGKKFADWIMERINKYDFVENRDY−−−−−IVFPNLGKN−−−−−−−−−−−LQGGRPSKDY−−−−−−−ALTLDM−−AKELSMVERN−−−−−−−−−−−−−−−−−−−−−−−−−−−EKGKQARL−−−−YFIE−−−−−−−−−−−−−−−−−−−−−−−−CERRAKQAAI−−−−−PQQIDYS−−−−S−−−−−−−−PKA−−−M−−−−−−M−−GFLNYLQGQIDQ−−−−−−−−−−−−−−−−QDTI−−−−−−−I−−−−EYLKPKAMALESLQRSDGLFGLTEAAKIL−−−−−−−−−−−−−−−−−−−−−EMQPKQFIQFLQKKGWVYRRTFGAPL−−−−−−−−LPYQ−−DKIQKGLMDCPTHTIQ−−TTEGTEK−−VVPAAKITTKGMGVLSQEM−−−−−−−−−K
fig|382640.5.peg.2332   Bartonella tribocorum CIP 105476              LHAFL−−−−−−−−−−−−−−EVGKHFSTWIKDRIKKYNLLENKDY−−−−−LVLPNFGEN−−−−−−−−−−−LQGGRPSKDY−−−−−−−ALTLNV−−AKELSMIENN−−−−−−−−−−−−−−−−−−−−−−−−−−−KKGREARL−−−−YFIE−−−−−−−−−−−−−−−−−−−−−−−−CERRAKQAAI−−−−−PQQIDYS−−−−S−−−−−−−−PKA−−−M−−−−−−M−−GFLNYLQGQINQ−−−−−−−−−−−−−−−−QDTI−−−−−−−I−−−−EYLKPKAMALESLQRSDGLFGLTEAAKIL−−−−−−−−−−−−−−−−−−−−−EMQPKQFIQFLQKKGWVYRRTFGAPL−−−−−−−−LPYQ−−DKIQKGLMDCPTHTVQ−−TENGTEK−−VIPSAKITTKGMGVLSQEM−−−−−−−−−K
fig|634504.3.peg.1028   Bartonella grahamii as4aup              LHAFL−−−−−−−−−−−−−−EIGKDFSTWIKDRIHQYEFEEGNDFIKTQDLRSPKLGSA−−−−−−−−−−−KSRAVTAIDY−−−−−−−HLTLDM−−AKELAMVERN−−−−−−−−−−−−−−−−−−−−−−−−−−−EKGKQARQ−−−−YFIE−−−−−−−−−−−−−−−−−−−−−−−−CERRAKKPLD−−−−−LANALE−−−−D−−−−−−−−PQF−−−V−−−−−−K−−KLLLESVTQLET−−−−−−−−−−−−−−−−LKSE−−−−−−−V−−−−STLKPKAMALESLQRHNGLFGLTEAAKIL−−−−−−−−−−−−−−−−−−−−−EMQPKQFILFLQKKGWVYRRAAGGNL−−−−−−−−LPYQ−−DKIQKKLMDCPTITLQ−−TASGIEK−−VIPCAKITAKGIGVLSQEL−−−−−−−−−K
fig|382640.5.peg.404   Bartonella tribocorum CIP 105476              LHAFL−−−−−−−−−−−−−−EAKRDFSNWIKDRITRYNFIEGQDFVKTQDLRSPNLASA−−−−−−−−−−−KSRAVIAINY−−−−−−−YLTLDR−−AKELSMLENN−−−−−−−−−−−−−−−−−−−−−−−−−−−QKGREARL−−−−YFIE−−−−−−−−−−−−−−−−−−−−−−−−CEKRVKQVVT−−−−−PQIDYS−−−−S−−−−−−−−PKA−−−M−−−−−−I−−GFLNYLQGQIDQ−−−−−−−−−−−−−−−−KDTI−−−−−−−I−−−−EDLTPKAMALESLQRHDGLFGLTEAAKIL−−−−−−−−−−−−−−−−−−−−−EMQPKQFIQFLQQKGWIYRRAAGGNL−−−−−−−−LPYQ−−DKIQKQLMDCPTITLQ−−TASGIEK−−VIPCAKITTKGMGLLSQEL−−−−−−−−−K
fig|382640.5.peg.598   Bartonella tribocorum CIP 105476              LHAFL−−−−−−−−−−−−−−EAKRDFSNWIKDRITRYNFIEGQDFVKTQDLRSPNLASA−−−−−−−−−−−KSRAVIAINY−−−−−−−YLTLDR−−AKELSMLENN−−−−−−−−−−−−−−−−−−−−−−−−−−−QKGREARL−−−−YFIE−−−−−−−−−−−−−−−−−−−−−−−−CEKRVKQAVT−−−−−PQIDYS−−−−S−−−−−−−−PKA−−−M−−−−−−I−−GFLNYLQGQIDQ−−−−−−−−−−−−−−−−KDTI−−−−−−−I−−−−EDLTPKAMALESLQRHDGLFGLTEAAKIL−−−−−−−−−−−−−−−−−−−−−EMQPKQFIQFLQQKGWIYRRAAGGNL−−−−−−−−LPYQ−−DKIQKQLMDCPTITLQ−−TSSGIEK−−VIPCAKITAKGIGVLSQEL−−−−−−−−−K
fig|360095.7.peg.1056   Bartonella bacilliformis KC583                 FL−−−−−−−−−−−−−−EVGRDFPTWIKNRVKEYNFQENQDF−−−−−IVFPQIGEN−−−−−−−−−−−LQGGRPSKDY−−−−−−−ALTLDM−−AKELSMVERN−−−−−−−−−−−−−−−−−−−−−−−−−−−EKGRQARH−−−−YFIE−−−−−−−−−−−−−−−−−−−−−−−−YEKLAKQIAA−−−−−PRIDYS−−−−N−−−−−−−−PEV−−−M−−−−−−L−−GFVTYLKSENER−−−−−−−−−−−−−−−−KDNV−−−−−−−I−−−−AKLEPKAQALEQLSRSDGLLCITDAAKIL−−−−−−−−−−−−−−−−−−−−−EMRPKDLFNRLQEKKWIYKRTVKSSF−−−−−−−−IPHQ−−DKMNIGVIDYHMTIIT−−KPDGSEL−−TIAQAKITSKG                  
fig|1224148.3.peg.4116   Dickeya chrysanthemi NCPPB 3533              LHIAL−−−−−−−−−−−−−−GVGRDFSTWIKSRIEEYGFIDNVDFLTFDSPIPVNQYTENGQLARQWKTSRGGDRRSKDY−−−−−−−VLSLNM−−AKELAMVERN−−−−−−−−−−−−−−−−−−−−−−−−−−−EQGRAVRR−−−−YFIQ−−−−−−−−−−−−−−−−−−−−−−−−CEEA−−−−−−−−−−−−−−−−−−−−−−−−−−LHRNVPEV−−−A−−−−−−A−−RFRRQLKARLTA−−−−−−−−−−−−−−−−−−−−−−−−−−−A−−−−NYFKPMCAALETARS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ELGKKT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LPHH−−YTTESNMIA−−−−RLVL−−−−−−GGLT−−AKDWAQVNG−−−−−VTGEP−−−−−−−−−R
fig|1224148.3.peg.8362   Dickeya chrysanthemi NCPPB 3533              LHIAL−−−−−−−−−−−−−−GVGRDFSTWIKSRIEEYGFIDNVDFLTFDSPIPVNQYTENGQLARQWKTSRGGDRRSKDY−−−−−−−VLSLNM−−AKELAMVERN−−−−−−−−−−−−−−−−−−−−−−−−−−−EQGRAVRR−−−−YFIQ−−−−−−−−−−−−−−−−−−−−−−−−CEEA−−−−−−−−−−−−−−−−−−−−−−−−−−LHRNVPEV−−−A−−−−−−A−−RFRRQLKARLTA−−−−−−−−−−−−−−−−−−−−−−−−−−−A−−−−NYFKPMCAALETARS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ELGKKT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LPHH−−YTTESNMIA−−−−RLVL−−−−−−GGLT−−AKDWAQVNG−−−−−VTGEP−−−−−−−−−R
fig|572265.5.peg.934   Hamiltonella defensa 5AT (Acyrthosiphon pisum)                                                                                                             TARLVDRWQQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LEQEKL−−−−LGFN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PND−−−E−−−−−−I−−AVLENLLQEKKH−−−−−−−−−−−−−NKELTHK−−−−−−−I−−−−EEMKPDVAALERIARSDDAMCVTDAAKQL−−−−−−−−−−−−−−−−−−−−−QLRPKDLFDFLSENKWIYRRLGSPW−−−−−−−−−IAYQ−−DKIQQGLIEHKVTTIT−−HTNGINE−−TKTQVRITPKG                  
fig|343509.12.peg.2389   Sodalis glossinidius str. 'morsitans'                                                                                                                  MVERN−−−−−−−−−−−−−−−−−−−−−−−−−−−EKGKEARQ−−−−YFIQ−−−−−−−−−−−−−−−−−−−−−−−−CEKQAKALPT−−−−−DPIQMLN−−−−D−−−−−−−−PAA−−−M−−−−−−R−−SIVLTYTEKVIA−−−−−−−−−−−−−−−−LENK−−−−−−−V−−−−EEMAPDVAAPHRIAKSDGGMCITNAAKGL−−−−−−−−−−−−−−−−−−−−−QVRPKDLFAFLRERGWIYRRIGYKNW−−−−−−−−MVYQ−−SKIQSGYLEHKISIVP−−CDDGTDK−−IREQVLVMPKGLAKLSQTF          
fig|343509.6.peg.2153   Sodalis glossinidius str. 'morsitans'                                                                                                          M−−AKELSMVERN−−−−−−−−−−−−−−−−−−−−−−−−−−−EKGKEARQ−−−−YFIQ−−−−−−−−−−−−−−−−−−−−−−−−CEKQAKALPT−−−−−DPIQMLN−−−−D−−−−−−−−PAA−−−M−−−−−−R−−SIVLTYTEKVIA−−−−−−−−−−−−−−−−LENK−−−−−−−V−−−−EEMAPDVAAPHRIAKSDGGMCITNAAKGL−−−−−−−−−−−−−−−−−−−−−QVRPKDLFAFLRERGWIYRRIGYKNW−−−−−−−−MVYQ−−SKIQSGYLEHKISIVP−−CDDGTDK−−IREQVLVMPKGLAKLSQTF          
fig|629741.3.peg.957   Kingella oralis ATCC 51147              LHAFL−−−−−−−−−−−−−−ESKQEFSNWIKNRIEDYGFLDGVDFLTNL−−−−−−−−−−−−−−−−−−−−−SKTQGRPRIDY−−−−−−−FLSLDM−−AKELSMVERN−−−−−−−−−−−−−−−−−−−−−−−−−−−AKGKQARQ−−−−YFID−−−−−−−−−−−−−−−−−−−−−−−−CEKRLSGSLKVDFND−−−−−−−−−−−−−−−−−−−−P−−−−−−−−−−−−L−−QAAKAFIEAETA−−−−−−−−−−−−−−−RRDAE−−−−−−−−−−−−RKLQIAGGALTRLGAAKGSQCLRESAKLL−−−−−−−−−−−−−−−−−−−−−KWQQTPFIDWLLVKKMLFRDAGKQL−−−−−−−−−CVYQ−−EYLGRGWFEYRT−−−−−−DEKNGH−−−−AFKQVMVTPLGLQKLAQKL          
fig|313606.3.peg.2217   Microscilla marina ATCC 23134                                    GFARKDSAKRTLEKNFTQSVDYQVFHSDVEN−−−−−−−−−−−−−−−−−PKGGRPAAMI−−−−−−−CLSIDC−−AKSFAMLAQT−−−−−−−−−−−−−−−−−−−−−−−−−−−EKGREVRL−−−−YFLE−−−−−−−−−−−−−−−−−−−−−−−−CEKRLKALTRGKNKLQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ILKESVETLIDHEER−−−−−−−−−−−−−ISDLEQE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−REEAKVY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LAAINK−−−−−−−−−−−−−−−−−−−−−−APSQ−−−−−−−TLF−−VDT                                             
fig|546266.6.peg.2645   Neisseria mucosa ATCC 25996              LHQFL−−−−−−−−−−−−−−ESKQHFADWIKNRINEYGFTQDVDFLGVHTVMSTEAGFF−−−−−−−−−−−−GQREKTVTDY−−−−−−−HLSLDM−−AKELCMVERN−−−−−−−−−−−−−−−−−−−−−−−−−−−DKGRQARR−−−−YFIE−−−−−−−−−−−−−−−−−−−−−−−−MEKQAKAL−−−−−−−−−−−−−−−−−−−−−−−−−−−PDA−−−V−−−−−−L−−YRIDALED−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AYFQAAPEMLALLRYRSMGLNLTEIGKLL−−−−−−−−−−−−−−−−−−−−−DMNPGAVSYRLKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LNDLG−−−−−−−−−−−−−−−−−−−−−−−F−−−−−−−−−L
fig|546266.6.peg.395   Neisseria mucosa ATCC 25996              LHKFL−−−−−−−−−−−−−−GVETRFDIWMNRRIEEYEFKQALDFIEVFKNDHVERGFF−−−−−−−−−−−−GKREIQVKTY−−−−−−−HLSLDM−−AKELCMVERN−−−−−−−−−−−−−−−−−−−−−−−−−−−DKGRQARR−−−−YFIE−−−−−−−−−−−−−−−−−−−−−−−−MEKQAKAL−−−−−−−−−−−−−−−−−−−−−−−−−−−PDA−−−V−−−−−−L−−YRIDALED−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AYFQAAPEMLALLRYRSMGLNLTEIGKLL−−−−−−−−−−−−−−−−−−−−−DMNPGAVSYRLKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LNDLG−−−−−−−−−−−−−−−−−−−−−−−F−−−−−−−−−L
fig|1145142.3.peg.1437   Neisseria meningitidis NM604                                    TPFSKWIQRRIEEYGFTQALDFIGVDKIVRTEAGFF−−−−−−−−−−−−GQRDKTVQGY−−−−−−−YLSLDM−−AKELCMVERN−−−−−−−−−−−−−−−−−−−−−−−−−−−DKGRQARR−−−−YFIE−−−−−−−−−−−−−−−−−−−−−−−−MEKQAKAL−−−−−−−−−−−−−−−−−−−−−−−−−−−PDA−−−V−−−−−−L−−YRIDALED−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AYFQAAPEMLALLRYRSMGLNLTEIGKLL−−−−−−−−−−−−−−−−−−−−−DMNPGAVSYRLKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LNDLG−−−−−−−−−−−−−−−−−−−−−−−F−−−−−−−−−L
fig|1145191.3.peg.1296   Neisseria meningitidis NM27              LHKFL−−−−−−−−−−−−−−GVETPFSKWIQRRIEEYGFTQALDFIGVDKIVRTEAGFF−−−−−−−−−−−−GQRDKTVQGY−−−−−−−YLSLDM−−AKELCMVERN−−−−−−−−−−−−−−−−−−−−−−−−−−−DKGRQARR−−−−YFIE−−−−−−−−−−−−−−−−−−−−−−−−MEKQAKAL−−−−−−−−−−−−−−−−−−−−−−−−−−−PDA−−−V−−−−−−L−−YRIDALED−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AYFQAAPEMLALLRYRSMGLNLTEIGKLL−−−−−−−−−−−−−−−−−−−−−DMNPGAVSYRLKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LNDLG−−−−−−−−−−−−−−−−−−−−−−−F−−−−−−−−−L
fig|469616.3.peg.1463   Fusobacterium mortiferum ATCC 9817              LHRFL−−−−−−−−−−−−−−GIATRFNDWIENRIKKYEFIEDYDYTKIL−−−−−−−−−−−−−−−−−−−−−VRNSRGRKYDY−−−−−−−AVKLDV−−AKELSMVENN−−−−−−−−−−−−−−−−−−−−−−−−−−−SRGREARV−−−−YFIQ−−−−−−−−−−−−−−−−−−−−−−−−CEKKLKVAQGKL−−−−−−−−−−−−−−−−−−−−−−−PKTYLEA−−−−−−L−−KELVKLEETKLS−−−−−−−−−−−−−−−−LENR−−−−−−−−−−−−−−−−−−−−−VNNLVHSRKLYTTTEIAKEL−−−−−−−−−−−−−−−−−−−−−GLKSANALNQLLEEDKIQYKVNGTW−−−−−−−−−−VLCS−−KYSDKEYVSIKQTELE−−NGK−−−−−−−IIYDRKWTGLGRNFLIERY          
fig|1138917.3.peg.1948   Enterococcus faecium E2039              LHEFL−−−−−−−−−−−−−−EVKDNYTDWFKRMITYGFDENVDFIGLSE−−−−−−−−−−−−−−−−−−KSDKLGGRPRIDH−−−−−−−AMKLDM−−AKEISMIQRT−−−−−−−−−−−−−−−−−−−−−−−−−−−EKGKQARQ−−−−YFIQ−−−−−−−−−−−−−−−−−−−−−−−−VEKEYKQQLLDTSNLS−−−−−−−−−−−−−−−−−−−PEL−−−Q−−−−−−MFQGIFTAVAKQEIA−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−KQLEAKIDSVSEIIALNTL                                                                                                                                   
fig|645663.4.peg.390   Enterococcus faecium E1039              LHEFL−−−−−−−−−−−−−−EVKDNYTDWFKRMITYGFDENVDFIGLSE−−−−−−−−−−−−−−−−−−KSDKLGGRPRIDH−−−−−−−AMKLDM−−AKEISMIQRT−−−−−−−−−−−−−−−−−−−−−−−−−−−EKGKQARQ−−−−YFIQ−−−−−−−−−−−−−−−−−−−−−−−−VEKEYKQQLLDTSNLS−−−−−−−−−−−−−−−−−−−PEL−−−Q−−−−−−MFQGIFTAVAKQEIA−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−KQLEAKIDSVSEIIALNTL                                                                                                                                   
fig|525318.3.peg.1980   Lactobacillus buchneri ATCC 11577              LHDFL−−−−−−−−−−−−−−EVETPYTKWIDRMMEYGFAENVDFSVFDKNVHDDTAFG−−−−−−−−−−−−−−GVRKMKDH−−−−−−−VLTLDM−−AKELSMIQRT−−−−−−−−−−−−−−−−−−−−−−−−−−−DRGKQARQ−−−−YFIA−−−−−−−−−−−−−−−−−−−−−−−−MEKQAKQIVL−−−−−−−−−−−−−−−−−−−−−−−−−PQTPEEK−−−−−−I−−TLLLQNANEGNK−−−KINQI−−DNRVKDLEHN−−−−−−−−−−−−KPLTPGE−−YNYISHAVGGAVNT−−−−−−−−−−−−−−−−−−−−−−−−−−−YVQTHHLILTGKQRGKLY−−−−−−−−−−−−−−−−−−−−−−KDINGGIKQIAR−−−−−−−−−−−−−−−−IQTRAQLREKDF                 
fig|212717.8.peg.1057   Clostridium tetani E88                                                                                     TSGQNREMW−−−−−−−FLTEDG−−LYEVLMQSRK−−−−−−−−−−−−−−−−−−−−−−−−−−−PIAKQFKK−−−−KVKEILKD−−−−−−−−IRKHGMYAKDELLDN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PDL−−−L−−−−−−I−−QVATKLKEEKAK−−−−−−−−−−−−−NKMLELQNKQKEQII−−−−GELKPRADYTDRILKNKGLVTITQIAKDY−−−−−−−−−−−−−−−−−−−−−GMTGTGLNKLLHELKVQYKQNDQW−−−−−−−−−−LLYK−−EHSGKGYTHSETIDIV−−RSDGRPD−−VKMNTKWTQKGRLFLYNLL          
fig|212717.1.peg.939   Clostridium tetani E88                                                                                     TSGQNREMW−−−−−−−FLTEDG−−LYEVLMQSRK−−−−−−−−−−−−−−−−−−−−−−−−−−−PIAKQFKK−−−−KVKEILKD−−−−−−−−IRKHGMYAKDELLDN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PDL−−−L−−−−−−I−−QVATKLKEEKAK−−−−−−−−−−−−−NKMLELQNKQKEQII−−−−GELKPRADYTDRILKNKGLVTITQIAKDY−−−−−−−−−−−−−−−−−−−−−GMTGTGLNKLLHELKVQYKQNDQW−−−−−−−−−−LLYK−−EHSGKGYTHSETIDIV−−RSDGRPD−−VKMNTKWTQKGRLFLYNLL          
fig|525374.3.peg.965   Staphylococcus epidermidis BCM-HMP0060                                                          KNVIRGLEKILTGSNVSSLIIPSEYKDSKGESRKEY−−−−−−−LLTKDGFTLYMFNIQGHN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EFKM−−−−AYINKFNE−−−−−−−−−−−−−−−−−−−−MENAIQNRL−−−−−−−−−−−−−−−−−−−−−−−−−−PGTYKEA−−−−−−L−−SQLLQTVEEKEK−−−−−−−−−−−−−−−−LELENNMNKQKI−−−−AEYEPKASYLDTILNNKSLVTVGQIAKDY−−−−−−−−−−−−−−−−−−−−−GMSAQALNKLLHDLKVQYKQSGQW−−−−−−−−−−LLYS−−NIQDKGYTHSSTTEIE−−HKDGSTS−−VRMNTKWTQKGRLFIYELL−−−−−−−−−K
fig|411470.6.peg.1902   Ruminococcus gnavus ATCC 29149              LHKAL−−−−−−−−−−−−−−GIRKRFSEWFEKN−−SQGFIENEDFSNPYLKVRVQIEGG−−−−−−−−−−−−REVQREVEDF−−−−−−−DLSVDM−−AKHICLMSRT−−−−−−−−−−−−−−−−−−−−−−−−−−−DKGRECRQ−−−−RLID−−−−−−−−−−−−−−−−−−−−−−−−LEKAWNT−−−−−−−−−−−−−−−−−−−−−−−−−−−−PEQ−−−V−−−−−−M−−ARALKTAGKTID−−−−−−SL−−KDRCKFLGGQVVEQQKLI−−−−EEMTPKANYVDHILESKSLVATTQIAKDY−−−−−−−−−−−−−−−−−−−−−GMSAVRFNRILNDMKIQYKVNKQW−−−−−−−−−−VLYS−−KYQNCGYVHSKTIDIT−−RSNGDPD−−VTMQTQWTQKGRLFLYEEL−−−−−−−−−K
fig|222523.6.peg.365   Bacillus cereus ATCC 10987              LHEAL−−−−−−−−−−−−−−EVKTAYKDWFPRMCEYGFEEGSDFSSFLSE−−−−−−−−−−−−−−−−−−−−STGGRPSIDH−−−−−−−QLTIDM−−AKELCMIQRT−−−−−−−−−−−−−−−−−−−−−−−−−−−PKGKECRQ−−−−YFLE−−−−−−−−−−−−−−−−−−−−−−−−IERRWNS−−−−−−−−−−−−−−−−−−−−−−−−−−−−PEA−−−I−−−−−−M−−ARALQIANQQLT−−−−−−QV−−RKQNKVLEGTIAVQNQQI−−−−AEMKPKVSYYDVVLNCKDLISTSAIAKDY−−−−−−−−−−−−−−−−−−−−−GKSAIWMNRYLNKKGVQFKQGGIW−−−−−−−−−−LLYQ−−KYAEKGYTSTKTHSYL−−GSNGQQH−−TKVHTYWTQKGRLFIYELM−−−−−−−−−K
fig|394503.6.peg.2928   Clostridium cellulolyticum H10              LHEAL−−−−−−−−−−−−−−EVKTAYKDWFPRMCEYGFEEGSDFSSFLSE−−−−−−−−−−−−−−−−−−−−STGGRPSIDH−−−−−−−QLTIDM−−AKELCMIQRT−−−−−−−−−−−−−−−−−−−−−−−−−−−PKGKECRQ−−−−YFLE−−−−−−−−−−−−−−−−−−−−−−−−IERRWNS−−−−−−−−−−−−−−−−−−−−−−−−−−−−PEA−−−I−−−−−−M−−ARALQIANQQLT−−−−−−QV−−RKQNKVLEGTIAVQNQQI−−−−AEMKPKVSYYDVVLNCKDLISTSAIAKDY−−−−−−−−−−−−−−−−−−−−−GKSAIWMNRYLNKKGVQFKQGGIW−−−−−−−−−−LLYQ−−KYAEKGYTSTKTHSYL−−GSNGQQH−−TKVHTYWTQKGRLFIYELM−−−−−−−−−K
fig|431943.4.peg.2709   Clostridium kluyveri DSM 555              LHAVL−−−−−−−−−−−−−−EVKTPYDKWFPRMCEYGFVEGTDFSTFLSE−−−−−−−−−−−−−−−−−−−−STGGRPAVDH−−−−−−−QITIDM−−AKELCMIQRT−−−−−−−−−−−−−−−−−−−−−−−−−−−PKGKQCRG−−−−YFLE−−−−−−−−−−−−−−−−−−−−−−−−IERRWNS−−−−−−−−−−−−−−−−−−−−−−−−−−−−PEA−−−I−−−−−−M−−ARALQFANQQLN−−−−−−QV−−RNQNKLLEGTIAVQNQQI−−−−AEMKPKVSYYDVVLNCKDLISTSAIAKDY−−−−−−−−−−−−−−−−−−−−−GKSAIWMNRYLNKKGVQFKQGGIW−−−−−−−−−−LLYQ−−KYAEKGYTSTKTHSYL−−GSNGQQH−−TKVHTYWTQKGRLFIYELM−−−−−−−−−K
fig|641112.4.peg.3849   Ruminococcus flavefaciens FD-1              LHAAL−−−−−−−−−−−−−−EVRTQYSIWFDRMCEYGFSEGIDYYSFLNNRSD−−−−−−−−−−−−−−−−−GLAGKPRTDH−−−−−−−QLTIDM−−AKELCMIQRT−−−−−−−−−−−−−−−−−−−−−−−−−−−EIGKRCRE−−−−YFIN−−−−−−−−−−−−−−−−−−−−−−−−LEKQWNS−−−−−−−−−−−−−−−−−−−−−−−−−−−−PDA−−−V−−−−−−M−−ARALQIADQKLE−−−−−−LA−−KQQNGSLIETTAVQAKQI−−−−EEMKPKATYCDMVLQSAGLMPITTIAKDY−−−−−−−−−−−−−−−−−−−−−GKSAKWLNKWLHEHGIQYKLGKVW−−−−−−−−−−LLYQ−−KYADRGYVKSKTFTVL−−DENGDSI−−AKPNTQWTQRGRMFIYEQL−−−−−−−−−K
fig|1154822.3.peg.466   Streptococcus agalactiae LMG 15093              LHNVL−−−−−−−−−−−−−−NIKTQYTKWLERMSEYGFEENVDYIAISQKRLTAQGNR−−−−−−−−−−−−−−−−TEYIDH−−−−−−−VLKLDM−−AKEIAMLQRN−−−−−−−−−−−−−−−−−−−−−−−−−−−EKSKQVRK−−−−YFIQ−−−−−−−−−−−−−−−−−−−−−−−−VEKDFNS−−−−−−−−−−−−−−−−−−−−−−−−−−−−PEK−−−I−−−−−−M−−ARALLMADKKIT−−−−−−NL−−TMENNQLQLD−−−−−−−L−−−−KEAQKQARYLDLIIESKGALRVTQIAADY−−−−−−−−−−−−−−−−−−−−−GMSVNKFNKTLLEFGVQHKVNGQW−−−−−−−−−−ILYK−−RHMGKGYTDSHTFDYQ−−DKNGHTR−−ANVTTTWTQKGRLFLYELL−−−−−−−−−K
fig|257314.1.peg.299   Lactobacillus johnsonii NCC 533              LHKAL−−−−−−−−−−−−−−GFKKKFSGWWEQN−−QDQFEKGIDFNEVPKGYIVESGNG−−−−−−−−−−−−−−TTRAYDDY−−−−−−−WLTVDT−−AKELCMMSRT−−−−−−−−−−−−−−−−−−−−−−−−−−−EKGKTIRK−−−−YFIQ−−−−−−−−−−−−−−−−−−−−−−−−VEKNWNS−−−−−−−−−−−−−−−−−−−−−−−−−−−−PEM−−−V−−−−−−M−−NRALQISKARVE−−−−−−KL−−EADNKSLSLQ−−−−−−−L−−−−EESNKKASYLDIILGTPDALAITQIAADY−−−−−−−−−−−−−−−−−−−−−GYGAVNFNKLLKQVGIQHKVNGQW−−−−−−−−−−ILYK−−VYMGKGYVVSQAFTFK−−DHLGKDR−−SKTTTYWTQKGRKLIYDVL−−−−−−−−−K
fig|575597.3.peg.982   Lactobacillus crispatus MV-3A-US              LYKGL−−−−−−−−−−−−−−ELKIRFSLWVSKN−−FDSFEEGQDFTSVSADTEVSNNGG−−−−−−−−−−−−−VQVRKLQDY−−−−−−−LLTIDM−−AKELCMMSKT−−−−−−−−−−−−−−−−−−−−−−−−−−−EKGKEVRK−−−−YFIE−−−−−−−−−−−−−−−−−−−−−−−−VERKWND−−−−−−−−−−−−−−−−−−−−−−−−−−−−PQE−−−I−−−−−−V−−KRGYAILQNENT−−−−−−QL−−KLENKNLTIQ−−−−−−−L−−−−EESNKKADYLDVILGTPDALAISQIAADY−−−−−−−−−−−−−−−−−−−−−GYSAVNFNKLLHKVGIQHKVNGQW−−−−−−−−−−ILYR−−AYMGKNYVTTKPFIYK−−DHKGNNR−−TSLSTYWTQAGRKLIYDVL−−−−−−−−−K
fig|575597.3.peg.1187   Lactobacillus crispatus MV-3A-US              LHEGL−−−−−−−−−−−−−−GLKKKFTDWWKQN−−SKDFEKNVDYTYSPKSAHVGNG−−−−−−−−−−−−−−−−GTRQIDDY−−−−−−−ALTIDM−−AKQLCLMSRT−−−−−−−−−−−−−−−−−−−−−−−−−−−EKGKQYRK−−−−YLIE−−−−−−−−−−−−−−−−−−−−−−−−VERKWND−−−−−−−−−−−−−−−−−−−−−−−−−−−−PQE−−−I−−−−−−V−−KRGYAILQNENT−−−−−−QL−−KLENKNLTIQ−−−−−−−L−−−−EESNKKASYLDVILGAPDALAVTQIAADY−−−−−−−−−−−−−−−−−−−−−GYNAKDFNELLHKVRIQHKVNGQW−−−−−−−−−−ILYK−−VYMGQGYVTTKPFTFI−−DHKGRTR−−SKPSTYWTQKGRKLIYDIL−−−−−−−−−K
fig|445970.5.peg.130   Alistipes putredinis DSM 17216                                                                                                      MTKDG−−FSFLVMGYTG−−−−−−−−−−−−−−−−−−−−−−−−−−−AKAGQFKE−−−−MFIA−−−E−−FNKREAMLKNDDYILARSQE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−I−−−−−−L−−HNRLKLAEQQLQ−−−−−−IA−−QGTIEKQEEA−−−−−−−I−−−−KTLTPKAQYTDEVLQSTSTYTLTQIAHDLGLRSV−−−−−−−−−−−−−−−−−−−HALTRILMEKKMLYRQSGQW−−−−−−−−−−QPTA−−KVADKGYFDTRTAKFV−−KSDNTIG−−TSMTTVITESGRQFL              
fig|535024.3.peg.1198   Bacillus subtilis subsp. subtilis str. SMY                                                                                                              QYVSKFEEM−−−−−−−−−−−−−−−−−−−−−−−−−−−EKALKARP−−−−SLIDTYLD−−MNED−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ERAIAYFTERKA−−−−−−K−−−−−−−RELQEQ−−−−−−−L−−−−TLAEPKVEKYDRFLNTDGLMKIGQVAKAIGIK−−−−−−−−−−−−−−−−−GMGQNNLFRFLRENKVLID−−GTNKN−−−−−−−−APYQ−−KYVERGFFQVKTQE−−−−−−−−TSVG−−IKTITLVTPKGADFIVDLL−−−−−−−−−K
fig|224308.49.peg.2095   Bacillus subtilis subsp. subtilis str. 168 [WGS]                                                                                                              QYVSKFEEM−−−−−−−−−−−−−−−−−−−−−−−−−−−EKALKARP−−−−SLIDTYLD−−MNED−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ERAIAYFTERKA−−−−−−K−−−−−−−RELQEQ−−−−−−−L−−−−TLAEPKVEKYDRFLNTDGLMKIGQVAKAIGIK−−−−−−−−−−−−−−−−−GMGQNNLFRFLRENKVLID−−GTNKN−−−−−−−−APYQ−−KYVERGFFQVKTQE−−−−−−−−TSVG−−IKTITLVTPKGADFIVDLL−−−−−−−−−K
fig|469604.7.peg.1110   Fusobacterium nucleatum subsp. vincentii 3_1_36A2              LHKFL−−−−−−−−−−−−−−EVGTRYNDWINRIIEKYNFIENKDFITITQKRVT−−−−−−−−−−−−−−−−AQGNETEFDDH−−−−−−−LMTIAM−−AKEIAMVSNT−−−−−−−−−−−−−−−−−−−−−−−−−−−EKGKEARI−−−−YFIK−−−−−−−−−−−−−−−−−−−−−−−−CEEAWNS−−−−−−−−−−−−−−−−−−−−−−−−−−−−PEM−−−I−−−−−−L−−ARANQIQSRMIE−−−−−−NY−−ADKIRILENK−−−−−−−I−−−−EENKPKVEFYNDVIDSKNTCDMQTVAKILNFK−−−−−−−−−−−−−−−−−GVGRNNLFEILRENKILQSNN−−−−−−−−−−−−−QPYQ−−KYVDNGWFRVIETKFN−−DYKTSEIK−−ISFKTVVFQKGIEKISILL−−−−−−−−−K
fig|526218.6.peg.838   Sebaldella termitidis ATCC 33386                                                                                                                                                               KVNE−−−−−−−−−−−−−−−−−−−−−−−−LQNKIKA−−−−−−−−−−−−−−−−−−−−−−−−−−−−PVTMKEA−−−−−−L−−LLALEQQEKIEA−−−−−−−−−−−−−−−−LELK−−−−−−−V−−−−IEDMPKVEFYDEVTGSKTTFTMDKVAKILNFK−−−−−−−−−−−−−−−−−KIGRNTLFDILRKNEILRSDN−−−−−−−−−−−−−TPYQ−−SYVDRGWFRLIESKFT−−KLDGETC−−ITYKTVVYQKGVDGILKLL−−−−−−−−−L
fig|500635.8.peg.80   Mitsuokella multacida DSM 20544                                                                                      TGKQYKRY−−−−−−−DITKMG−−CEMVANKLTG−−−−−−−−−−−−−−−−−−−−−−−−−−−QKGIMFTA−−−−KYVEIFNK−−−−−−−−−−−−−−−MAEQIIEERTDSYMITD−−−−−−−−−−−−−−−−−−−−−−−P−−−−−−−−−−−−V−−KRAKKWIEEETE−−−−−−−−−−−−−RQKLRAE−−−−−−−N−−−−KEMLPKAQFYDTVANTESLFSMADVAKTL−−−−−DM−−−−−−−−−−−−−−GIGRNKLFAFLRNKGILDKDN−−−−−−−−−−−−−HPYQ−−KYVDAGYLRLVEDHCK−−AGDNDV−−−VYKCTYVKQKGIDYIRKIL−−−−−−−−−L
fig|445337.5.peg.1816   Clostridium botulinum C str. Eklund                                     TDSRDVARMVDKKHSHLMRDIRGYIEILRESNLGFSDFFIESTYKTEGNNKTYECY−−−−−−−LVTKKG−−CEMIANKMIG−−−−−−−−−−−−−−−−−−−−−−−−−−−KKGVLFTA−−−−TYVDAFNK−−−−−−−−−−−−−−−−−−−−MEESLRQITTYKL−−−−−−−−−−−−−−−−−−−−−−PQTYAEA−−−−−−L−−RELADRAEENEK−−−−−−−−−−−−−−−−LKEE−−−−−−−N−−−−YIMLPKAEFYDAVTKSEDTIDMGECAKVL−−−−−NM−−−−−−−−−−−−−−GIGRNNLFKFLRNHDVLMSNN−−−−−−−−−−−−−IPYQ−−RFVDNKYFKIIEKEFE−−KPNGEIK−−INTKTVVYQKGLDYIRKLL−−−−−−−−−K
fig|449673.7.peg.735   Bacteroides stercoris ATCC 43183                                                                                                                                                                                           LENEKKVIKT−−−−−−−−−−−−−−−−−−−−−−−−−PQTYLEA−−−−−−L−−EALVASEKEKEQLRIETEQQ−−QKQIEQKDAK−−−−−−−I−−−−TKLQPKADFAEAAFKAEGKVDIGQAAKIL−−−−−NL−−−−−−−−−−−−−−GFGRNTLFGKLRDAGIFFKDRN−−−−−−−−−−−−EPKQ−−KYIDAGYFEMTLLPPI−−RRDNHPDILCQKVFCKPKGLAYINHLF          
fig|585502.3.peg.2168   Prevotella bergensis DSM 17361                                                                                                                                                                                           LDN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PGL−−−V−−−−−−I−−RMATQLKQERAE−−−−KARL−−EAESKQKDNQ−−−−−−−I−−−−KKLQPKAAFAEKAFDMKDKVDVGMAAKIL−−−−−NL−−−−−−−−−−−−−−GFGRNTLFKNLRETGVFFASKN−−−−−−−−−−−−EPKQ−−RFVDAKYFEMTEHPIY−−DNNGELIKVVAKVLVTQKGLAYINHLF          
fig|645127.4.peg.1691   Corynebacterium kroppenstedtii DSM 44385                                                 MGYARWEDFYKITRRAEASAKNSGQGGFSVITEKAPEGGRPRTDF−−−−−−−HLNRLA−−AYLVAMNGDP−−−−−−−−−−−−−−−−−−−NK−−−−−−PEVAAAQS−−−−YFALRTRE−−AETK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PSFDPAALTRAEIL−−QIALNAEEERLA−−−−−−−−−−−−−−−−LEAE−−−−−−−N−−−−KELSPKAEAYDTFLDATGKYSVGAVAKML−−−−−−−−−−−−−−−−−−−−−GKGQNWLFRELRNRGVLITKGAMRN−−−−−−−−TPYQ−−QYMH−−HFEVLPHHYE−−RSDGTQG−−TSYTTYVQPSGIDFIRRKL          
fig|500633.7.peg.532   Clostridium hiranonis DSM 13275     NEDMTISISIEDAAEVLGLVKITKSNGKEYRNMRLDRINKYSQEYGFSHKWEKGD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YIPESF−−FYWLAFKVEN−−−−−−−−−−−−−−−−−−−−−−−−−−−EHAKNFRK−−−−NFSLALRD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−L−−RIKTYLDNTQKA−−−−−−−−−−−−−−−−−−−ESRDILLLE−−−−ENFKATEEILERIVGRTNSITLRGMAKLISSEGK−−−−−−−−−−−−−−AISERGLKEILKMWNILLKNGK−−−−−−−−−−−−EPTQ−−YALERGICE−−−−YSFY−−KNN−−−−−−−KNPVVLITQRGQLFILKKF          
fig|445337.5.peg.1820   Clostridium botulinum C str. Eklund                                                                                      TVVQGVQQ−−−−−−−YLTENM−−LYDFMLEART−−−−−−−−−−−−−−−−−−−−−−−−−−−EKCKSFRK−−−−WVTN−−−E−−VLPT−−IRKTGGYVNEGKEEEF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−I−−−−−−D−−NYFPTLSEDTKK−−−−−−−−−−−AMVKDLQKS−−−−−−−V−−−−KELKPKADGYDRMINAKNNQTMNQVAKSL−−−−−−−−−−−−−−−−−−−−−QVGRNKLFSFLRQQNILMKNN−−−−−−−−−−−−−LPYQ−−RFIAQGYFAVREFTKTIY−−−−GEDK−−NLTQTLVTAKGIDYIHNKL−−−−−−−−−K
fig|343509.12.peg.1714   Sodalis glossinidius str. 'morsitans'                                                                                                                                                  IKRWHDLEK−−−−LAAK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PVLPENY−−−−−−I−−SALEALLESKKS−−−−−−EA−−ALVLVNKEQE−−−−−−−A−−−−EIHDLKNLFKEGMTST−−−−−−−QFCKML−−−N−−−−−−−−−−−−−−−−−GVNTQKVNGWLAERNWLYNESKSGIR−−−−−−−−WRAT−−SYARDKYLTEHQHMIS−−VHGADDF−−IKYQPVLLRKGAERIYDLY          
fig|343509.6.peg.1557   Sodalis glossinidius str. 'morsitans'                                                                                                                                                  IKRWHDLEK−−−−LAAK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PVLPENY−−−−−−I−−SALEALLESKKS−−−−−−EA−−ALVLVNKEQE−−−−−−−A−−−−EIHDLKNLFKEGMTST−−−−−−−QFCKML−−−N−−−−−−−−−−−−−−−−−GVNTQKVNGWLAERNWLYNESKSGIR−−−−−−−−WRAT−−SYARDKYLTEHQHMIS−−VHGADDF−−IKYQPVLLRKGAERIYDLY          
fig|323097.3.peg.3721   Nitrobacter hamburgensis X14                                                                                                             TARLV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DRWQELET−−−−QASR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PAL−−−P−−−−−−A−−NYAAALRELAST−−−−−−−−−−VEVVEQQQAL−−−−−−−I−−−−SEQQPKVEFYDQFVKADGLLGYQEAGTAA−−−−−−−−−−−−−−−−−−−−−GCYPNKFCNWLKIDHLFYRGKKL−−−−−−−−−−−MPRS−−QFVRRGLFEIRPELDA−−DGE−−−−−−−SHLRGWVTAKGVEHF              
fig|323097.6.peg.4365   Nitrobacter hamburgensis X14                                                                                                             TARLV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DRWQELET−−−−QASR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PAL−−−P−−−−−−A−−NYAAALRELAST−−−−−−−−−−VEVVEQQQAL−−−−−−−I−−−−SEQQPKVEFYDQFVKADGLLGYQEAGTAA−−−−−−−−−−−−−−−−−−−−−GCYPNKFCNWLKIDHLFYRGKKL−−−−−−−−−−−MPRS−−QFVRRGLFEIRPELDA−−DGE−−−−−−−SHLRGWVTAKGVEHF              
fig|411481.5.peg.222   Bifidobacterium adolescentis L2-32                                                                                                             MYKLIMRSRK−−−−−−−−−−−−−−−−−−−−−−−−−−−PEAKEFQR−−−−WVTH−−−E−−VLPS−−IRKHGAYMTQQTLDKALTS−−−−−−−−−−−−−−−−−−−−−−−−−−−−PDF−−−L−−−−−−I−−QLATKLKEEQEK−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−−−KELEPKAKALDDFTNVPDALLVRDAAKLLSNDSNI−−−−−−−−−−−−−−QIGEHELRQWLVDNGWIYRQSNQSW−−−−−−−−−CAAS−−SRVRQGHMVMVSSRSHGIHKDGTPFAYPPTPKLTRKGLALIHQRL          
fig|566552.4.peg.774   Bifidobacterium catenulatum DSM 16992                                                                                                                                                  KEAAEALDK−−−−YFNE−−−−−−−−−GGAIRVSD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ADSDEDI−−−−−−M−−ARAVLVAQKTIK−−−−−−QK−−NQQIASQQSR−−−−−−−I−−−−DELQPKASAWDNFVDIDDALSVRDSAKLLSNLGR−−−−−−−−−−−−−−−TVGQTELFEWLDRHDWIFRENKHW−−−−−−−−−−SARQ−−SRINAGHLMMVPSKSHGTHKDGTPFAFPPTVKVTRKGLALIARRF          
fig|471856.5.peg.2371   Jonesia denitrificans DSM 20603                                                                                     GGGNPVRIA−−−−−−−LLNEQQ−−ATLLMTFMRN−−−−−−−−−−−−−−−−−−−−−−−−−−−TEQVVAFKV−−−−ALVDAFYQ−−MAKT−−LRPTV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PQTYAEA−−−−−−L−−RAAADAADAADA−−−−−−−−−−−−−LSQKEQV−−−−−−−I−−−−ALLEPKAASWDSVVSSAGSWSFNDAAKVLHESGQI−−−−−−−−−−−−−−DIGEKRLVRALVDWGYLYRDHKKRP−−−−−−−−−HVYQ−−RFVEQGLFVAKARTYK−−DLKTGIEMASSAPQVRITGKG                  
fig|596312.3.peg.1641   Micrococcus luteus SK58                                                         LCAVLEIGRQQDATRYLDADEKRGCLVDTPSGPQTMV−−−−−−−VVTEAG−−MYSLVLRSRK−−−−−−−−−−−−−−−−−−−−−−−−−−−PEAKAFKR−−−−WLTH−−−−−EVLPA−−IRKTGAYSVQRELTE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DEI−−−−−−−−−−I−−HRALTLTVAKVE−−−−−−−−−−−−−−−ALEAK−−−−−−−V−−−−AEDAPKVAAWESIVSSAGSWSYNDAAKVLCESGQI−−−−−−−−−−−−−−EIGEKRLVKALVDWGYLYRDAKGRP−−−−−−−−−HVYQ−−RYVEQGLFVVKARTYR−−DLVSGEVRESAAPQVRLTGKG                  
fig|272623.7.peg.480   Lactococcus lactis subsp. lactis Il1403                                                                                                     FISEPM−−VYKLAFKANN−−−−−−−−−−−−−−−−−−−−−−−−−−−AVSEKFTD−−−−WLAV−−−−−EVLPT−−IRKHGAYMTDSKLEEALLN−−−−−−−−−−−−−−−−−−−−−−−−−−−−PDT−−−L−−−−−−I−−NLATQLKQEREE−−−−−−−−−−−−−KAQLRALNSTLAVEN−−−−QIMQPKAQYFDDLVERNLLTSFRDTAKML−−−−−−−−−−−−−−−−−−−−−KVGQKQLIDWLLENKYIYRDKKNKL−−−−−−−−−MPYA−−QYNNDLFEIKESK−−−−−−−−GATNSWKGAQTLITPVGRETFNLLL          
fig|445972.6.peg.1965   Anaerotruncus colihominis DSM 17241                                                                                                     FIPENV−−FYRLAMKAKN−−−−−−−−−−−−−−−−−−−−−−−−−−−EAAEAFQA−−−−KIAD−−−−−EVIPA−−IRKHGAYMTPETLEAAIMN−−−−−−−−−−−−−−−−−−−−−−−−−−−−PDI−−−M−−−−−−I−−RLCTALKNEQEK−−−−−−−−−−−−−RKALETVNSALTVDN−−−−QIMRPKADYFDELVDRNLLTNFRETAKQL−−−−−−−−−−−−−−−−−−−−−EIKEKNFIGFLLEKKYIYRDKRGKL−−−−−−−−−LPYA−−DKNNGLFEVKECF−−−−−−−−NEKTQWSGTQTLVTPKGRETFRLLY−−−−−−−−−L
fig|634176.4.peg.454   Aggregatibacter aphrophilus NJ8700                                                                                                                                                     LPDFTN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PA−−−−−−−−−−−−−−ESALAWAEEYEK−−−−−−−−−−−−−RQIAEQQ−−−−−−−A−−−−ALMKPKADFVDNYVSAGGSKSLRETAKIL−−−−−−−−−−−−−−−−−−−−−KMPERDLIMKLISDKCLYRTSGNGNL−−−−−−−−LPYQ−−SRHSQDLFTVKTGVTD−−NGH−−−−−−−NYTQTRVTAKGIQWIANRY          
fig|374932.4.peg.75   Haemophilus influenzae PittHH                                                                                                                                                       EFTA−−−−AVVDRWQA−−−−−−−−−−−−−−−−−−−−LENRQKPTALI−−−−−−−−−−−−−−−−−−−−−−−−PQSFSEA−−−−−−L−−MLAAQLQAEK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ERNAPKVAFVDHYVEIGTSKSFRETAKIL−−−−−−−−−−−−−−−−−−−−−KIPERALVNRLVEDKYLYRQSGVL−−−−−−−−−−LPYQ−−SAHTKDLFTVKTGTAE−−HGH−−−−−−−NYTQTRVTSKGIEFIASRY          
fig|374930.9.peg.936   Haemophilus influenzae PittEE                                                                                                                                                                VVDRWQA−−−−−−−−−−−−−−−−−−−−LENRQKPTALI−−−−−−−−−−−−−−−−−−−−−−−−PQSFSEA−−−−−−L−−MLAAQLQAEK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ERNAPKVAFVDHYVEVGTSKSFRETAKIL−−−−−−−−−−−−−−−−−−−−−KIPERALVNRLVEDKYLYRQSGVL−−−−−−−−−−LPYQ−−SAHTKDLFTVKTGTAE−−HGH−−−−−−−NYTQTRITSKG                  
fig|375177.4.peg.751   Haemophilus influenzae 3655                                                                                                                                                       EFTA−−−−AVVDRWQA−−−−−−−−−−−−−−−−−−−−LENRQKPTALI−−−−−−−−−−−−−−−−−−−−−−−−PQSFSEA−−−−−−L−−MLAAQLQAEK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ERNAPKVAFVDHYVEVGTSKSFRETAKIL−−−−−−−−−−−−−−−−−−−−−KIPERALVNRLVEDKYLYRQSGVL−−−−−−−−−−LPYQ−−SAHTKDLFTVKTGTAE−−HGH−−−−−−−NYTQTRVTSKDIEFIASRY          
fig|521004.3.peg.265   Haemophilus influenzae 6P18H1                                                                                                                                                       EFTA−−−−AVVDRWQA−−−−−−−−−−−−−−−−−−−−LENRQKPTALI−−−−−−−−−−−−−−−−−−−−−−−−PQSFSEA−−−−−−L−−MLAAQLQAEK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ERNAPKVAFVDHYVEVGTSKSFRETAKIL−−−−−−−−−−−−−−−−−−−−−KIPERALVNRLVEDKYLYRQSGVL−−−−−−−−−−LPYQ−−SAHTKDLFTVKTGTAE−−HGH−−−−−−−NYTQTRVTSKGIEFIASRY          
fig|262727.1.peg.974   Haemophilus influenzae R2846                                                                                                                                                       EFTA−−−−AVVDRWQA−−−−−−−−−−−−−−−−−−−−LENQQKPTALI−−−−−−−−−−−−−−−−−−−−−−−−PQSFSEA−−−−−−L−−MLAAQLQAKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ERNAPKVAFVDHYVEVGTSKSFRETAKIL−−−−−−−−−−−−−−−−−−−−−KIPERALVNRLVEDKYLYRQSGVL−−−−−−−−−−LPYQ−−SAHTKDLFTVKTGTAE−−HGH−−−−−−−NYTQTRITSKG                  
fig|262728.5.peg.905   Haemophilus influenzae R2866                                                                                                                                                       EFTA−−−−AVVDRWQA−−−−−−−−−−−−−−−−−−−−LENQQKPTALI−−−−−−−−−−−−−−−−−−−−−−−−PQSFSEA−−−−−−L−−MLAAQLQAEK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ERNAPKVAFVDHYVEVGTSKSFRETAKIL−−−−−−−−−−−−−−−−−−−−−KIPERALVNRLVEDKYLYRQSGVL−−−−−−−−−−LPYQ−−SAHTKDLFTVKTGTAE−−HGH−−−−−−−NYTQTRVTSKGIEFIASRY          
fig|374931.10.peg.178   Haemophilus influenzae PittGG                                                                                                                                                       EFTA−−−−AVVDRWQA−−−−−−−−−−−−−−−−−−−−LENQQKPTALI−−−−−−−−−−−−−−−−−−−−−−−−PQSFSEA−−−−−−L−−MLSAQLQAEK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ERNAPKVAFVDHYVEVGTSKSFRETAKIL−−−−−−−−−−−−−−−−−−−−−KMPERALVNRLVEDKYLYRQSGVL−−−−−−−−−−LPYQ−−SAHTKDLFTVKTGTSE−−HGH−−−−−−−NYTQTRVTSKGIEFI              
fig|281310.6.peg.1595   Haemophilus influenzae 86-028NP                                                                                                 NGQTYYEYHLTKRDSLIVVAQN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−CPEFTA−−−−AIVDRWQA−−−−−−−−−−−−−−−−−−−−LENQQKPTALI−−−−−−−−−−−−−−−−−−−−−−−−PQSFSEA−−−−−−L−−MLAAQLQAEK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ERNAPKVAFVDHYVEVGTSKSFRETAKIL−−−−−−−−−−−−−−−−−−−−−KMPERALVNRLVEDKYLYRQSGVL−−−−−−−−−−LPYQ−−SARTKDLFTVKTGTAE−−HGH−−−−−−−NYTQTRVTSKGIEFIASRY          
fig|324831.10.peg.557   Lactobacillus gasseri ATCC 33323              LYKGL−−−−−−−−−−−−−−GIKRRFSAWWEQN−−SNDFKENSDFQRVL−−−−−ISTPRENR−−−−−−−−−−GSIELQDY−−−−−−−ALTIDM−−AKQLCLLSRT−−−−−−−−−−−−−−−−−−−−−−−−−−−SKGKEYRE−−−−YLIE−−−−−−−−−−−−−−−−−−−−−−−−VEKK−−−−−−−−−−−W−−−−−−−−−−−−−−NN−−−PDM−−−I−−−−−−M−−QRALTIANNRVK−−−−−−LL−−ETEKRELKETNARQAAKI−−−−AKDADDVVFAKAIRYSHHAIPVGELAEILTQNGF−−−−−−−−−−−−−−VIGRNQLFQLLREEKYLSSFNHSWN−−−−−−−−VPMT−−QMVKRGLFRITHNLTR−−DGRGYSQ−−−−−−TWVTPKGQKYIINKA−−−−−−−−−L
fig|324831.10.peg.608   Lactobacillus gasseri ATCC 33323              LYKGL−−−−−−−−−−−−−−GIKRRFSAWWEQN−−SNDFKENSDFQRVL−−−−−ISTPRENR−−−−−−−−−−GSIELQDY−−−−−−−ALTIDM−−AKQLCLLSRT−−−−−−−−−−−−−−−−−−−−−−−−−−−SKGKEYRE−−−−YLIE−−−−−−−−−−−−−−−−−−−−−−−−VEKK−−−−−−−−−−−W−−−−−−−−−−−−−−NN−−−PDM−−−I−−−−−−M−−QRALTIANNRVK−−−−−−LL−−ETEKRELKETNARQAAKI−−−−AKDADDVVFAKAIRYSHHAIPVGELAEILTQNGF−−−−−−−−−−−−−−VIGRNQLFQLLREEKYLSSFNHSWN−−−−−−−−VPMT−−QMVKRGLFRITHNLTR−−DGRGYSQ−−−−−−TWVTPKGQKYIINKA−−−−−−−−−L
fig|324831.13.peg.573   Lactobacillus gasseri ATCC 33323              LYKGL−−−−−−−−−−−−−−GIKRRFSAWWEQN−−SNDFKENSDFQRVL−−−−−ISTPRENR−−−−−−−−−−GSIELQDY−−−−−−−ALTIDM−−AKQLCLLSRT−−−−−−−−−−−−−−−−−−−−−−−−−−−SKGKEYRE−−−−YLIE−−−−−−−−−−−−−−−−−−−−−−−−VEKK−−−−−−−−−−−W−−−−−−−−−−−−−−NN−−−PDM−−−I−−−−−−M−−QRALTIANNRVK−−−−−−LL−−ETEKRELKETNARQAAKI−−−−AKDADDVVFAKAIRYSHHAIPVGELAEILTQNGF−−−−−−−−−−−−−−VIGRNQLFQLLREEKYLSSFNHSWN−−−−−−−−VPMT−−QMVKRGLFRITHNLTR−−DGRGYSQ−−−−−−TWVTPKGQKYIINKA−−−−−−−−−L
fig|324831.13.peg.634   Lactobacillus gasseri ATCC 33323              LYKGL−−−−−−−−−−−−−−GIKRRFSAWWEQN−−SNDFKENSDFQRVL−−−−−ISTPRENR−−−−−−−−−−GSIELQDY−−−−−−−ALTIDM−−AKQLCLLSRT−−−−−−−−−−−−−−−−−−−−−−−−−−−SKGKEYRE−−−−YLIE−−−−−−−−−−−−−−−−−−−−−−−−VEKK−−−−−−−−−−−W−−−−−−−−−−−−−−NN−−−PDM−−−I−−−−−−M−−QRALTIANNRVK−−−−−−LL−−ETEKRELKETNARQAAKI−−−−AKDADDVVFAKAIRYSHHAIPVGELAEILTQNGF−−−−−−−−−−−−−−VIGRNQLFQLLREEKYLSSFNHSWN−−−−−−−−VPMT−−QMVKRGLFRITHNLTR−−DGRGYSQ−−−−−−TWVTPKGQKYIINKA−−−−−−−−−L
fig|559301.5.peg.725   Lactobacillus gasseri MV-22              LYKGL−−−−−−−−−−−−−−GIKRRFSAWWEQN−−SNDFKENSDFQRVL−−−−−ISTPRENR−−−−−−−−−−GSIELQDY−−−−−−−ALTIDM−−AKQLCLLSRT−−−−−−−−−−−−−−−−−−−−−−−−−−−SKGKEYRE−−−−YLIE−−−−−−−−−−−−−−−−−−−−−−−−VEKK−−−−−−−−−−−W−−−−−−−−−−−−−−NN−−−PDM−−−I−−−−−−M−−QRALTIANNRVK−−−−−−LL−−ETEKRELKEANARQAAKI−−−−AKDADDVVFAKAIRYSHHAIPVGELAEILTQNGF−−−−−−−−−−−−−−VIGRNQLFQLLREEKYLSSFNHSWN−−−−−−−−VPMT−−QMVKRGLFRITHNLTR−−DGRGYSQ−−−−−−TWVTPKGQKHIINKA−−−−−−−−−L
fig|559301.5.peg.787   Lactobacillus gasseri MV-22              LYKGL−−−−−−−−−−−−−−GIKRRFSAWWEQN−−SNDFKENSDFQRVL−−−−−ISTPRENR−−−−−−−−−−GSIELQDY−−−−−−−ALTIDM−−AKQLCLLSRT−−−−−−−−−−−−−−−−−−−−−−−−−−−SKGKEYRE−−−−YLIE−−−−−−−−−−−−−−−−−−−−−−−−VEKK−−−−−−−−−−−W−−−−−−−−−−−−−−NN−−−PDM−−−I−−−−−−M−−QRALTIANNRVK−−−−−−LL−−ETEKRELKEANARQAAKI−−−−AKDADDVVFAKAIRYSHHAIPVGELAEILTQNGF−−−−−−−−−−−−−−VIGRNQLFQLLREEKYLSSFNHSWN−−−−−−−−VPMT−−QMVKRGLFRITHNLTR−−DGRGYSQ−−−−−−TWVTPKGQKHIINKA−−−−−−−−−L
fig|575604.3.peg.756   Lactobacillus gasseri SV-16A-US              LYKGL−−−−−−−−−−−−−−EIRTRFSLWVSQN−−FKEFEKGSDFQPVV−−−−−ITTPRENR−−−−−−−−−−GSIELQDY−−−−−−−ALTIDM−−AKQLCLLSRT−−−−−−−−−−−−−−−−−−−−−−−−−−−QKGKEYRE−−−−YLIE−−−−−−−−−−−−−−−−−−−−−−−−VEKK−−−−−−−−−−−W−−−−−−−−−−−−−−NN−−−PDM−−−I−−−−−−M−−QRALTIANNRVK−−−−−−LL−−ETEKRELKEANAKQAAKI−−−−AKDADDVVFAKAIRYSHHAIPVGELAEILTQNGF−−−−−−−−−−−−−−VIGRNQLFQLLREEKYLSSFNHSWN−−−−−−−−VPMT−−QMVKRGLFRITHNLTK−−DGRGYSQ−−−−−−TWVTPKGQKHIINKA−−−−−−−−−L
fig|575604.3.peg.971   Lactobacillus gasseri SV-16A-US              LHKTL−−−−−−−−−−−−−−GAKKKYSEWISQN−−VAGFIVGVDFTRSPESYLVKSGNG−−−−−−−−−−−−−−TVRKYDDV−−−−−−−LLTIET−−AKQICMMSKT−−−−−−−−−−−−−−−−−−−−−−−−−−−SRGKEVRK−−−−YFIQ−−−−−−−−−−−−−−−−−−−−−−−−VEKN−−−−−−−−−−−W−−−−−−−−−−−−−−NN−−−PDM−−−I−−−−−−M−−QRALNIASSRVK−−−−−−LL−−ENKNKELEDVNAKQAEKI−−−−AKDADDVVFAKAIRYSHHAITIAELADILTQNGF−−−−−−−−−−−−−−VIGRNQLFQLLRHAKYLSHQRSTWN−−−−−−−−LPMT−−DKVKRGYFRITHRLTR−−DNRPYSQ−−−−−−VFVTPKGQKHIINKA−−−−−−−−−L
fig|257314.1.peg.308   Lactobacillus johnsonii NCC 533              LANVL−−−−−−−−−−−−−−GYSNT−−−−−−−−−−QKAIRDHIDPDDLRGERIVTPSG−−−−−−−−−−−−−−−−−−KQMTI−−−−−−−ITNESG−−MYSLILSSKL−−−−−−−−−−−−−−−−−−−−−−−−−−−PSAKKFKR−−−−WVTS−−−E−−VLPA−−IREDGAYITDNKAMQL−−−−−−−−−−−−−−−−−−−−−−−−−MSD−−−PQE−−−−−−−−−−L−−GNFLLTIGNRVK−−−−−−AL−−EAEKKELKDTNAKQAAKI−−−−ARDADDVVFAKAIRYSHHAIPVGELAEILTQNGF−−−−−−−−−−−−−−VIGRNQLFQLLREEKYLSSFNHSWN−−−−−−−−VPMT−−QMVKRGLFRITHNLTR−−DGRGYSQ−−−−−−TWVTPKGQKHIINKA−−−−−−−−−L
fig|553220.3.peg.581   Campylobacter gracilis RM3268                  L−−−−−−−−−−−−−−GYANTYAMLERLDDDEKTNLKDLLKSRMP−−−EI−−SDL−−−PRI−−−D−−GV−−RYDAV−−−−−−−LLSESG−−LYNAILWSEK−−−−−−−−−−−−−−−−−−−−−−−−−−−PQAKEFRR−−−−WVTG−−−E−−VLPA−−IRKHGGYLTPAKIEEV−−−−−−−−−−−L−−−−−−−−−−−−−−SD−−−PDT−−−I−−−−−−I−−ALAQNLKTERAK−−−−−−R−−−−−−−KQLEAE−−−−−−−K−−−−AANAGYVSFAKSVEASVDSILIGNYAKLLSDSEGV−−−−−−−−−−−−−−SIGQNRLFDFLRASGYLISGGARHN−−−−−−−−VPMQ−−RYVDRGYFEVTTQTFA−−GPAGTHQ−−−KFTTKITGKGQIALAGKI          
fig|553218.4.peg.1444   Campylobacter rectus RM3267              VCKIL−−−−−−−−−−−−−−−−−−−−−DLTNASVVKNAITSEFDDGLSLTYPIFDSLGR−−−−−−−−−−−−−−−−−EQNAT−−−−−−−FITEPQ−−LYFVLMRSDK−−−−−−−−−−−−−−−−−−−−−−−−−−−PNARSFRK−−−−WVNI−−−E−−VLPS−−IRKHGGYLTQKKIDEVLSD−−−−−−−−−−−−−−−−−−−−−−−−−−−−PDT−−−I−−−−−−I−−KLALDLKAQRAK−−−−−−−−−−−−−TQELERE−−−−−−−K−−−−AANLPYITFAKAVEASATSINIGDYAKALCDDKRI−−−−−−−−−−−−−−RVGQKRLFSWLRDSGYLQKDN−−−−−−−−−−−−−KPYQ−−KYVDNGYFELVMNVIA−−TTKGNLQ−−−TFTTKITSKGQVALAPKI          
fig|349741.3.peg.1447   Akkermansia muciniphila ATCC BAA-835              VCDAL−−−−−−−−−−−−−−EIGNVSQAVSYLDEDEKSNI−−−−−−−−−−−−−−−−−−ITNDIA−−−QNGGR−−−−APL−−−−−−−IINESG−−LYSLILRSRK−−−−−−−−−−−−−−−−−−−−−−−−−−−PEAKKFKK−−−−WVTA−−−E−−VLPS−−IRKHGVYATGEKLEEM−−−−−−−−−−−L−−−−−−−−−−−−−−AD−−−PDT−−−M−−−−−−I−−LTLQALKAEREK−−−−−−R−−−−−−−KALEAK−−−−−−−A−−−−AEDAPYAYFGRCVEVSEGCILIGEFAKILAQNGM−−−−−−−−−−−−−−ETGQNRLFEYLRNEGIMGRHGNRHN−−−−−−−−VPAQ−−EYIEAGYFRLTYRVIQ−−RSDGSQQ−−SKPTPYLTPRGQIWLMKRL          
fig|349741.6.peg.1543   Akkermansia muciniphila ATCC BAA-835              VCDAL−−−−−−−−−−−−−−EIGNVSQAVSYLDEDEKSNI−−−−−−−−−−−−−−−−−−ITNDIA−−−QNGGR−−−−APL−−−−−−−IINESG−−LYSLILRSRK−−−−−−−−−−−−−−−−−−−−−−−−−−−PEAKKFKK−−−−WVTA−−−E−−VLPS−−IRKHGVYATGEKLEEM−−−−−−−−−−−L−−−−−−−−−−−−−−AD−−−PDT−−−M−−−−−−I−−LTLQALKAEREK−−−−−−R−−−−−−−KALEAK−−−−−−−A−−−−AEDAPYAYFGRCVEVSEGCILIGEFAKILAQNGM−−−−−−−−−−−−−−ETGQNRLFEYLRNEGIMGRHGNRHN−−−−−−−−VPAQ−−EYIEAGYFRLTYRVIQ−−RSDGSQQ−−SKPTPYLTPRGQIWLMKRL          
fig|572547.3.peg.1169   Aminobacterium colombiense DSM 12261              VCDVL−−−−−−−−−−−−−−GYSNA−−−−−−−−−−RDAVNNHVRIKHR−−−DA−−VAIPD−−−−−−−AMGR−−NQLTS−−−−−−−VISEPG−−LYSLVLRSKL−−−−−−−−−−−−−−−−−−−−−−−−−−−PSAVRFQD−−−−WVTE−−−E−−VLPA−−IRKHSAYLTPQKIEEV−−−−−−−−−−−L−−−−−−−−−−−−−−CN−−−PDT−−−I−−−−−−I−−RLATDLKKEREQ−−−−−−R−−−−−−−LRLASK−−−−−−−V−−−−REDAPKVIFAESVSASHTSILVGDLAKLLRQNGI−−−−−−−−−−−−−−QMGQNRLFDWLRRRGYLIKSGSSRN−−−−−−−−MPTQ−−RAMELGLFEIKERTIN−−NPDGSVR−−ITRTPKVTGKGQIYFANIF−−−−−−−−−L
fig|596326.3.peg.2275   Lactobacillus jensenii 208-1              VAEVL−−−−−−−−−−−−−−GYRNT−−−−−−−−−−RDALKKHVDNEDKKSEIVNSSQLSQ−−−−−−−−NATG−−YQNID−−−−−−−LITESG−−VYSLIFGSKL−−−−−−−−−−−−−−−−−−−−−−−−−−−PTAKKFKH−−−−WVTS−−−E−−VLPA−−IREHGAYMTDEKAFDV−−−−−−−−−−−V−−−−−−−−−−−−−−NN−−−−−−−−−K−−−−−−A−−GLADLLQQAADQ−−−−−−L−−−−−−−KQKDIQ−−−−−−−I−−−−AEMKPKALFADSVATSNSTILVGELAKILRGNGI−−−−−−−−−−−−−−EIGQNRLFDWLRKNGYLISKKGSSYN−−−−−−−−LPTQ−−KSMNLGLFKIKETTIN−−HSNGSVS−−ISKTAKVTGKGQQYFINKF−−−−−−−−−L
fig|440497.10.peg.893   Lactobacillus jensenii 1153                                                                       SQ−−−−−−−−NATG−−YQNID−−−−−−−LITESG−−VYSLIFGSKL−−−−−−−−−−−−−−−−−−−−−−−−−−−PTAKKFKH−−−−WVTS−−−E−−VLPA−−IREHGAYMTDEKAFDV−−−−−−−−−−−V−−−−−−−−−−−−−−NN−−−−−−−−−K−−−−−−A−−GLADLLQQAADQ−−−−−−L−−−−−−−KQKDIQ−−−−−−−I−−−−AEMKPKALFADSVATSNSTILVGELAKILRGNGI−−−−−−−−−−−−−−EIGQNRLFDWLRKNGYLISKKGSSYN−−−−−−−−LPTQ−−KSMNLGLFKIKETTIN−−HSNGSVS−−ISKTAKVTGKGQQYFINKF−−−−−−−−−L
fig|575607.3.peg.1536   Lactobacillus jensenii SJ-7A-US                                                                                                     VISESG−−LYSLILSSKL−−−−−−−−−−−−−−−−−−−−−−−−−−−PTAKKFKH−−−−WVTS−−−E−−VLPA−−IRKHGAYMTDEKAFDV−−−−−−−−−−−V−−−−−−−−−−−−−−NN−−−−−−−−−K−−−−−−S−−GLADLLQQAADQ−−−−−−L−−−−−−−KQKDIQ−−−−−−−I−−−−AELKPKALFADSVATSDSTILVGELAKILRGNGI−−−−−−−−−−−−−−EIGQNRLFDWLRTNGYLISKKGSSYN−−−−−−−−LPTQ−−KSMNLGLFKIKE