(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00020687

fig|220668.1.peg.2022   Lactobacillus plantarum WCFS1                                                                                                                  QF−−−TGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DVNGKDIYEGD−−−−−IVKV−−−−−−−−−−−−−−−−−−−−−−−−−−−WSDMSELTMVPVIN−−−EIVS−−−−−−EDLF−−−−−−−−−−−−−−GIPGMFLKP−−VGTHLIEP−−−−−−−−−−−−−−−−−−−−−−−−CLHDSWSNQFEIIGNVHENPELLK    
fig|220668.9.peg.2054   Lactobacillus plantarum WCFS1                                                                                                                  QF−−−TGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DVNGKDIYEGD−−−−−IVKV−−−−−−−−−−−−−−−−−−−−−−−−−−−WSDMSELTMVPVIN−−−EIVS−−−−−−EDLF−−−−−−−−−−−−−−GIPGMFLKP−−VGTHLIEP−−−−−−−−−−−−−−−−−−−−−−−−CLHDSWSNQFEIIGNVHENPELLK    
fig|1328309.5.peg.1262   Lactobacillus plantarum IPLA88          NVIVNGKNETWDIK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NDDV−−−ELLQF−−−TGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DVNGKDIYVGD−−−−−IVNV−−−−−−−−−−−−−−−−−−−−−−−−−−−WSNMSELKMEPKVN−−−EIVS−−−−−−EDLF−−−−−−−−−−−−−−GTPGMFLKS−−LKAHFIEP−−−−−−−−−−−−−−−−−−−−−−−−CLHDYWSNQFEVIGNVHENPELLE−−−E
fig|220668.9.peg.546   Lactobacillus plantarum WCFS1                                                                                                 DALD−−−ASDF−−−KLEQF−−−TGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DVNGKDIYEGD−−−−−VLKT−−−−KAGLIQIVEQG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ILET−−−−DRED−−−−−−−−−−−−−−−−IINGFYANN−−LSDEKPHTF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SYDDEVIGNVHENPELLE    
fig|220668.1.peg.552   Lactobacillus plantarum WCFS1      MIKF−−−−−−−−RVWDN−−−−ECKVIRDYDELK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GLTLDALD−−−ASDF−−−KLEQF−−−TGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DVNGKDIYEGD−−−−−VLKT−−−−KAGLIQIVEQG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ILET−−−−DRED−−−−−−−−−−−−−−−−IINGFYANN−−LSDEKPHTF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SYDDEVIGNVHENPELLE    
fig|553178.3.peg.722   Capnocytophaga gingivalis ATCC 33624      TIKF−−−−−−−−RAKTK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NGEWIYNLAPLVPFSVSDPTD−−−FDRD−−−TLTQF−−−TGLH−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DCHGVEIYEGD−−−−−FLKI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NLSEGYKIR−−−LVCY−−−−−−NE−−−−−−−−−−−−−−−−DVMGFCLAH−−LEDWNDPF−−−−−−−−−−−−−−−LYNLYQFSFSWWERFKNDIEVIGNRYDNPE       
fig|515621.3.peg.2021   Clostridium botulinum Ba4 str. 657       IKF−−−−−−−−RAWDN−−−−TTKEM−−−−−−−−−−LQLQKMSFKTSKC−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MPYGGNIE−−−YEFD−−−NLMQY−−−TGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DIDNKEIYEGD−−−−−ILQG−−−−−−−−−−−−−−−−−−−−−−−−−−GYVNKLTGKFESRLY−−−IVEF−−−−−−EK−−−−−−−−−−−−−−−−G−−TFKGKL−−IGESLYGD−−−−−−−−−−−−−−−−−−−−−−−−TWLNFINKKSYVIGNIYENPELLE−−−V
fig|525338.3.peg.1702   Lactobacillus plantarum subsp. plantarum ATCC 14917      MIKF−−−−−−−−RAWDKATSSYRKVL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EIEFYPDGELKKVKVAGLQRKGAIT−−−PDKL−−−VLEQF−−−TGLT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DMSDKDIYEGD−−−−−ILQP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VISY−−−−−−TKRNIGKPFEVKKGNYVYG−−KWIAKD−−VFSKEFGV−−−−−−−−−−−−−−−−−−−−−−−−−DGYYFSNEMRLIGNVHTNPELLE−−EK
fig|279010.12.peg.1443   Bacillus licheniformis ATCC 14580                                                                                                         DEYELISRDLY−−−TGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DNTDREIYEGD−−−−−IIHC−−−−−−−−−−−−−−−−−−−−−−−−−VHWFFDGNEIEEHFTA−−−SVGF−−−−−−RD−−−−−−−−−−−−−−−−G−−SFTLEN−−INSRYYSD−−−−−−−−−−−YTFEENGKGICWIGDINYCDEDYEIIGNIYQNPDLL     
fig|469604.7.peg.1132   Fusobacterium nucleatum subsp. vincentii 3_1_36A2       IKF−−−−−−−−RVWDK−−−−NDKRI−−−−−−−−−FIDPQMIDFYNKIIGYMQYQTEYMPD−−−−−−−−−−−−−−−−−−−−−−−−−TSYSIPVG−−−FEEFEYSELMEW−−−TGLY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNGEDIYEGD−−−−−IVKL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RANHGIG−−−VIKY−−−−−−SD−−−−−−−−−−−−−−−−EWGAFVVEY−−IKPRPLAV−−−−−−−−−−−−−−−−−−−−−−−−LGMNYYKEDIEVLGNIYQNPELLG−−E 
fig|469604.7.peg.849   Fusobacterium nucleatum subsp. vincentii 3_1_36A2       IKF−−−−−−−−RAWLK−−−−EKKEM−−−−−−−−−−IDNARPDFFCKQLNYLRGNSAG−−−−−−−−−−−−−−−−−−−−−−−−−−−−GQDVLGVS−−−TEDI−−−ELMQY−−−TGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNNKEIYEGD−−−−−IVKL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RSNHGIG−−−VIKY−−−−−−YD−−−−−−−−−−−−−−−−EWGAFVVEY−−IKPRPLAV−−−−−−−−−−−−−−−−−−−−−−−−LGMNYYKEDIEVLENIYETPELIK−−−E
fig|556264.3.peg.1452   Fusobacterium sp. D11       IKF−−−−−−−−RAWLK−−−−EKKEM−−−−−−−−−−IDNARPDFFCRQLHYLRGNSAG−−−−−−−−−−−−−−−−−−−−−−−−−−−−GQDVLGVS−−−TEDI−−−ELMQY−−−TGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNNKEIYEED−−−−−IVKL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RANHGIG−−−VIKY−−−−−−YD−−−−−−−−−−−−−−−−EWGAFVVEY−−IKPRPLAV−−−−−−−−−−−−−−−−−−−−−−−−LGMNYYKEDIEVLGNIYQNPELLG−−EQ
fig|556264.8.peg.1424   Fusobacterium nucleatum subsp. animalis D11       IKF−−−−−−−−RAWLK−−−−EKKEM−−−−−−−−−−IDNARPDFFCRQLHYLRGNSAG−−−−−−−−−−−−−−−−−−−−−−−−−−−−GQDVLGVS−−−TEDI−−−ELMQY−−−TGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNNKEIYEED−−−−−IVKL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RANHGIG−−−VIKY−−−−−−YD−−−−−−−−−−−−−−−−EWGAFVVEY−−IKPRPLAV−−−−−−−−−−−−−−−−−−−−−−−−LGMNYYKEDIEVLGNIYQNPELLG−−EQ
fig|634994.3.peg.734   Leptotrichia hofstadii F0254       IKF−−−−−−−−RVFIDYKIFYQDKY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DEYGDNLTSIDICKKTITITGFHNYENVYRFE−−−DEKV−−−KLMQY−−−TGTK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNNKEIYEGD−−−−−IVKI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IKQEGYGEYYN−−−QVEY−−TAKIEH−−−−−−−−−−−−−−−−CISEFGLQP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LNLKLSDESIVEIEVIGNIYENKNLLEENK
fig|445334.5.peg.2763   Clostridium perfringens C str. JGS1495       IKF−−−−−−−−RAWDR−−−−YKERM−−−−−−−−−−GEIDKFHLKDKECSLILDN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GDKVIHFY−−−YDEI−−−DIMQY−−−TGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNRKEIYEGD−−−−−ILSI−−−−−−−−−−−−−−−−−−−−−−−−−−−KIYSGDKVIVEGKT−−−VVEF−−−−−−KD−−−−−−−−−−−−−−−−G−−CFGVIW−−GHDKAFLS−−−−−−−−−−−−−−−−−−−−−−−−−LNSFFKAKFEVIGNIYENPELL     
fig|431943.8.peg.3404   Clostridium kluyveri DSM 555       IKF−−−−−−−−RAWDE−−−−QARRIINWEELKFDKDNGDDSICFYEK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDDCEWNG−−−GADY−−−KLMQY−−−TGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNGVEIYEGD−−−−−ILHI−−−−−−−−−−−−−−−−−−−−−−−−EIENWHIKGDIIASGNE−−−VVEY−−−−−−QE−−−−−−−−−−−−−−−−C−−CFGVIW−−GYHRDFIK−−−−−−−−−−−−−−−−−−−−−−−−−LNGFTNTTFEVIGNIYSNPELLKEGE
fig|515621.3.peg.2022   Clostridium botulinum Ba4 str. 657       IKF−−−−−−−−RFWDN−−−−VINNMYYGEEINKSKNDLRSNWYCITKKDGLMVGN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VGPSGMDN−−−−YDL−−−IIMQY−−−TGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNGKEIYEGD−−−−−IVSI−−−−−−−−−−−−−−−−−−−−−−−−EIKDKTIENKIIASSNE−−−VVEY−−−−−−KD−−−−−−−−−−−−−−−−C−−KFGVVW−−GWHKDFIG−−−−−−−−−−−−−−−−−−−−−−−−−LDGFYNANFEVVGNIYENPVLLE    
fig|413999.4.peg.1628   Clostridium botulinum A str. ATCC 3502                                                                                                                LGQY−−−TGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DINGKEIYEGD−−−−−ILQI−−−−−−−−−−−−−−−−−−−−−−−−NIKDKTIKNKIISAGNE−−−VVEY−−−−−−KN−−−−−−−−−−−−−−−−C−−KFGVVW−−GWHRDFIG−−−−−−−−−−−−−−−−−−−−−−−−−LDGFYNANFEVVGNIYENPVLLE    
fig|536232.3.peg.2397   Clostridium botulinum A2 str. Kyoto       IKF−−−−−−−−RAWDK−−−−IDEKI−−−−−−−−−−REVTLIDFEYKKVKLLNDY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TDESYLRN−−−FEEV−−−ILLEY−−−TGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DVNNKEFYEGD−−−−−ILHI−−−−−−−−−−−−−−−−−−−−−−−−EIKDKKIKNKIIASSNE−−−VVEH−−−−−−KG−−−−−−−−−−−−−−−−Y−−KFGVVW−−GGHRDFIG−−−−−−−−−−−−−−−−−−−−−−−−−LAGFYNTTFKVIGNVYEDSKLLQ−−EG
fig|413999.4.peg.2251   Clostridium botulinum A str. ATCC 3502       IKF−−−−−−−−RAWDK−−−−IDEKI−−−−−−−−−−REITLIDFEYKKVKLLNDY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TGESYLRD−−−FEEV−−−ILLEY−−−TGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNGKEIYEGN−−−−−ILHI−−−−−−−−−−−−−−−−−−−−−−−−EIKDKSIKDKIIASSNE−−−VVKY−−−−−−KD−−−−−−−−−−−−−−−−C−−KFGVVW−−GWHRDFIG−−−−−−−−−−−−−−−−−−−−−−−−−LDGFYNTAFQVIGNVYEDPKLLQ−−EG
fig|525254.4.peg.1634   Anaerococcus lactolyticus ATCC 51172      MDKY−−−−−−−−RAWDK−−−−LNDKM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KGVCCVDWYIKQTVCTEDGEPVYYMD−−−FEDI−−−KLMRF−−−TGIT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNGKEIYEGD−−−−−ILHW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KDKSKAGDGSLEENVIVYW−−−−−−SN−−−−−−−−−−−−−−−−EFLAWTVQG−−DDWSVDEP−−−−−−−−−−−−−−−−−−−−−PHYLFEYKDPGEIEVIGNIYE          
fig|553218.4.peg.1445   Campylobacter rectus RM3267       IKF−−−−−−−−RAWHI−−−−KERKM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YFLEAIDMCFELVTVTKKNSDEQDYAAYFR−−−FSEI−−−ELMQY−−−AGVK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DQNNAEIYEGD−−−−−IVKF−−−−−−−−−−−−−−−−−−−−−−DPQSPCGDEFYNPRDGEIG−−−EVIF−−−−−−DF−−−−−−−−−−−−−−−−G−−NFIVRP−−VDKKREDL−−−−−−−−−−−−−−−−−−−−−−−−RFSLSELGDWVVVGNIYENK        
fig|469621.8.peg.495   Fusobacterium periodonticum 1_1_41FAA                                                                                                        FNDI−−−EFMQY−−−TGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNNKEIYEGD−−−−−IIKF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LNGIF−−−EVIW−−−−−−CN−−−−−−−−−−−−−−−−EKASFMLKN−−KEYKEFLN−−−−−−−−−−−−−−−−−−−−−−−−−FIYENNNGMEIVGNIYQNLELYEEVR
fig|457405.3.peg.558   Fusobacterium sp. 7_1        KM−−−−−−−−KAWLK−−−−KENKM−−−−−−−−−−VSIIGIDLNYQYIRYSDDGNLF−−−−−−−−−−−−−−−−−−−−−−−−−−−−KDDYKIAE−−−FKDI−−−ELLQF−−−TGAK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKAGQEVYEAD−−−−−VIKF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NDGIDDIYG−−−LISY−−−−−−DD−−−−−−−−−−−−−−−−EDAVYCVSY−−ENVTEHLL−−−−−−−−−−−−−−−−−−−−−−−−−−−−NMAGNFEIVGNIFENPNLHE    
fig|457405.9.peg.745   Fusobacterium nucleatum subsp. animalis 7_1        KM−−−−−−−−KAWLK−−−−KENKM−−−−−−−−−−VSIIGIDLNYQYIRYSDDGNLF−−−−−−−−−−−−−−−−−−−−−−−−−−−−KDDYKIAE−−−FKDI−−−ELLQF−−−TGAK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKAGQEVYEAD−−−−−VIKF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NDGIDDIYG−−−LISY−−−−−−DD−−−−−−−−−−−−−−−−EDAVYCVSY−−ENVTEHLL−−−−−−−−−−−−−−−−−−−−−−−−−−−−NMAGNFEIVGNIFENPNLHE    
fig|469606.8.peg.731   Fusobacterium nucleatum subsp. vincentii 4_1_13        KM−−−−−−−−KAWLK−−−−KENKM−−−−−−−−−−VSIIGIDLNYQYIRYTDDGNLF−−−−−−−−−−−−−−−−−−−−−−−−−−−−KDDYKIAE−−−FKDI−−−ELLQF−−−TGAK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKAGQEVYEAD−−−−−VIKF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NDGIDDIYG−−−LISY−−−−−−DD−−−−−−−−−−−−−−−−EDAVYCVSY−−ENVTEHLS−−−−−−−−−−−−−−−−−−−−−−−−−−−−NMAGDFEIVGNIFENPDLHE    
fig|556264.3.peg.447   Fusobacterium sp. D11        KM−−−−−−−−KAWLK−−−−KEKKM−−−−−−−−−−VSIIGIDLNYQYIRYSDDGNLF−−−−−−−−−−−−−−−−−−−−−−−−−−−−KDDYKIAE−−−FKDI−−−ELLQF−−−TGAK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKAGQEVYEAD−−−−−VIKF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NDGIDDIYG−−−LISY−−−−−−DD−−−−−−−−−−−−−−−−EDAVYCVSY−−ENVTEHLS−−−−−−−−−−−−−−−−−−−−−−−−−−−−NMAGDFEIVGNIFENPDLHE    
fig|556264.8.peg.470   Fusobacterium nucleatum subsp. animalis D11        KM−−−−−−−−KAWLK−−−−KEKKM−−−−−−−−−−VSIIGIDLNYQYIRYSDDGNLF−−−−−−−−−−−−−−−−−−−−−−−−−−−−KDDYKIAE−−−FKDI−−−ELLQF−−−TGAK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKAGQEVYEAD−−−−−VIKF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NDGIDDIYG−−−LISY−−−−−−DD−−−−−−−−−−−−−−−−EDAVYCVSY−−ENVTEHLS−−−−−−−−−−−−−−−−−−−−−−−−−−−−NMAGDFEIVGNIFENPDLHE    
fig|393480.8.peg.1436   Fusobacterium nucleatum subsp. polymorphum ATCC 10953       IKF−−−−−−−−RAWYK−−−−EKKRI−−−−−−−−−−GKVLGIDILHKEIYFSNED−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDCYGHTE−−−FKDI−−−ELMQY−−−TGMK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DVTEKEIYEGD−−−−−VVKL−−−−−−−−−−−−−−−−−−−−−VHTGIEISADRLEDLKRFVG−−−IIKY−−−−−−EN−−−−−−−−−−−−−−−−G−−IFKIVR−−TEKSLIES−−−−−−−−−−−−KYFEMEQKKVSEIFIYSKLYDLEVIGNIFENKELLE−−IK
fig|457405.3.peg.1573   Fusobacterium sp. 7_1       IKF−−−−−−−−RAWHK−−−−EKKIM−−−−−−−−−−GEVLGIDILHKEIFFSNED−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDCYEHTD−−−FKDI−−−ELMQY−−−TGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DMREKEIYEGD−−−−−ILFE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SFGEEYF−−−KVVF−−−−−−KD−−−−−−−−−−−−−−−−G−−SFRLET−−GGCSLPLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−EYSHICEVVGNIYENSELLG−−−E
fig|457405.9.peg.1568   Fusobacterium nucleatum subsp. animalis 7_1       IKF−−−−−−−−RAWHK−−−−EKKIM−−−−−−−−−−GEVLGIDILHKEIFFSNED−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDCYEHTD−−−FKDI−−−ELMQY−−−TGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DMREKEIYEGD−−−−−ILFE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SFGEEYF−−−KVVF−−−−−−KD−−−−−−−−−−−−−−−−G−−SFRLET−−GGCSLPLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−EYSHICEVVGNIYENSELLG−−−E
fig|469599.3.peg.2159   Fusobacterium sp. 2_1_31                                                                                                                 MQY−−−TGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNNKEIYEGD−−−−−ILFE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SFGERYY−−−KVVF−−−−−−KN−−−−−−−−−−−−−−−−G−−NFRTEF−−EGYFDEYS−−−−−−−−−−−−−−−−−−−−−−−FDLIDVVLDLCEINGNIYENSELMEEVR
fig|469621.8.peg.1607   Fusobacterium periodonticum 1_1_41FAA       IKF−−−−−−−−RAWVK−−−−DRKAI−−−−−−−−−−FEVVLINYVSKKVTYLFERVGH−−−−−−−−−−−−−−−−−−−−−−−−−−−−LLNIRHEK−−−FNDV−−−ELMQY−−−SGLT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DMMEKEIYEGD−−−−−ILFE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SFGERYY−−−KVVF−−−−−−KN−−−−−−−−−−−−−−−−G−−SFRAEF−−EGDFEEHS−−−−−−−−−−−−−−−−−−−−−−−FDLIDVVAQGCKIVGNIYENPELIE    
fig|138119.3.peg.407   Desulfitobacterium sp. Y51      RLKF−−−−−−−−RVWNK−−−−VSKKM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−HNPQAISFDIQNCNPFAVSIPAKSWDP−−−AEKY−−−ELLQW−−−TGLR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DESGTDVYEAD−−−−−LVLI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DYEIY−−−RVHW−−−−−−HE−−−−−−−−−−−−−−−−SEAAFKLIS−−LKGSLEKE−−−−−−−−−−−−−−−−−−−−−−−−−−−AGLLPTGKIIGNTYETENL      
fig|1090321.3.peg.796   Desulfitobacterium hafniense PCP-1      RLKF−−−−−−−−RVWNK−−−−VSKKM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−HNPQAISFDIQNCNPFAVSIPAKSWDP−−−AEKY−−−ELLQW−−−TGLR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DEGGTDVYEAD−−−−−LVLI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DYEIY−−−KVHW−−−−−−HE−−−−−−−−−−−−−−−−SEAAFKLIS−−LKGSLEKE−−−−−−−−−−−−−−−−−−−−−−−−−−−AGLLPTGKIIGNTYETENL      
fig|979222.3.peg.411   Staphylococcus epidermidis NIH04008              MLPMKVWDE−−−−QEKRMWFVQSLHIEDEWIRANDGS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IYGEKKDL−−−VRNF−−−KLLYP−−−TAQT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNGQPIYQGD−−−−−IVKV−−−−−−−−−−−−−−−−−−−DNHPLQTKDIDNLNIKVGMDINGLYVVEY−−−−−−IE−−−−−−−−−−−−−−−−EEMAFVIGN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LKPRAVIRHAEVVGNIYETPHLLE    
fig|585153.3.peg.2606   Staphylococcus aureus subsp. aureus E1410     MMLKF−−−−−−−−KAWDK−−−−DKKVM−−−−−−−−−−SIIDEIDFNSGYI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LISTGYKS−−−FDEV−−−KVLQY−−−TGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNNTEIYDGD−−−−−IAEF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KYPHDKRFKEIG−−−IITH−−−−−−SA−−−−−−−−−−−−−−−−EKACFVIKM−−IRDTVQEF−−−−−−−−−−−−−−−−−−−−−−−ELYRGVANSYLKVIGNKFENPELLEESE
fig|186153.1.peg.21   Staphylococcus aureus phage phi 13     MMPKF−−−−−−−−RAWDK−−−−DKKVM−−−−−−−−−−SFIDEIDFNSGYI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LISTGYKS−−−FNEV−−−KLLQY−−−TGFK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DVHGVEIYEGD−−−−−IVQD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SYSGEVS−−−FIEF−−−−−−KE−−−−−−−−−−−−−−−−G−−AFYITF−−SNVTELIS−−−−−−−−−−−−−−−−−−−−−−−−−−−−ENDDIIEIIGNIFENEELLEVMR
fig|553577.3.peg.2983   Staphylococcus aureus A8796     MMLKF−−−−−−−−KAWDK−−−−DKKVM−−−−−−−−−−SIIDEIDFNSGYI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LISTGYKS−−−FNEV−−−KLLQY−−−TGFK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DVHGVEIYEGD−−−−−IVQD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−CYSREVS−−−FIEF−−−−−−KE−−−−−−−−−−−−−−−−G−−AFYITF−−SNVTELLS−−−−−−−−−−−−−−−−−−−−−−−−−−−−ENDDIIEIV               
fig|1158692.3.peg.1244   Staphylococcus aureus M0687      MLKF−−−−−−−−KAWDK−−−−DKKVM−−−−−−−−−−SIIDEIDFNSGYI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LISTGYKS−−−FNEV−−−KLLQY−−−TGFK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DVHGVEIYEGD−−−−−IVQD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−CYSREVS−−−FIEF−−−−−−KE−−−−−−−−−−−−−−−−G−−AFYITF−−SNVTELLS−−−−−−−−−−−−−−−−−−−−−−−−−−−−ENDDIIEIVGNIFENEMLLEVMR
fig|1169274.3.peg.999   Staphylococcus aureus M1309      MLKF−−−−−−−−KAWDK−−−−DKKVM−−−−−−−−−−SIIDEIDFNSGYI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LISTGYKS−−−FNEV−−−KLLQY−−−TGFK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DVHGVEIYEGD−−−−−IVQD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−CYSREVS−−−FIEF−−−−−−KE−−−−−−−−−−−−−−−−G−−AFYITF−−SNVTELLS−−−−−−−−−−−−−−−−−−−−−−−−−−−−ENDDIIEIVGNIFENEMLLEVMR
fig|1331008.3.peg.173   Staphylococcus aureus subsp. aureus CBD-635      MLKF−−−−−−−−KAWDK−−−−DKKVM−−−−−−−−−−SIIDEIDFNSGYI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LISTGYKS−−−FNEV−−−KLLQY−−−TGFK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DVHGVEIYEGD−−−−−IVQD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−CYSREVS−−−FIEF−−−−−−KE−−−−−−−−−−−−−−−−G−−AFYITF−−SNVTELLS−−−−−−−−−−−−−−−−−−−−−−−−−−−−ENDDIIEIVGNIFENEMLLEVMR
fig|553577.3.peg.2987   Staphylococcus aureus A8796                                                                                                TGYKS−−−FNEV−−−KLLQY−−−TGFK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DVHGVEIYEGD−−−−−IVQD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−CYSREVS−−−FIEF−−−−−−KE−−−−−−−−−−−−−−−−G−−AFYITF−−SNVTELLS−−−−−−−−−−−−−−−−−−−−−−−−−−−−ENDDIIEIVGNIFENEMLLEVMR
fig|359787.11.peg.372   Staphylococcus aureus subsp. aureus JH1     MMLKF−−−−−−−−KAWDK−−−−DKKVM−−−−−−−−−−SIIDEIDFNSGYI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LISTGYKS−−−FNEV−−−KLLQY−−−TGFK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DVHGVEIYEGD−−−−−IVQD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−CYSREVS−−−FIEF−−−−−−KE−−−−−−−−−−−−−−−−G−−AFYITF−−SNVTELLS−−−−−−−−−−−−−−−−−−−−−−−−−−−−ENDDIIEIVGNIFENEMLLEVMR
fig|1158481.3.peg.1480   Staphylococcus aureus M1255     MMLKF−−−−−−−−KAWDK−−−−DKKVM−−−−−−−−−−SIIDEIDFNSGYI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LISTGYKS−−−FNEV−−−KLLQY−−−TGFK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DVHGVEIYEGD−−−−−IVQD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−CYSREVS−−−FIEF−−−−−−KE−−−−−−−−−−−−−−−−G−−AFYITF−−SNVTELLS−−−−−−−−−−−−−−−−−−−−−−−−−−−−ENDDIIEIVGNIFENEMLLEVMR
fig|1158481.3.peg.1994   Staphylococcus aureus M1255     MMLKF−−−−−−−−KAWDK−−−−DKKVM−−−−−−−−−−SIIDEIDFNSGYI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LISTGYKS−−−FNEV−−−KLLQY−−−TGFK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DVHGVEIYEGD−−−−−IVQD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−CYSREVS−−−FIEF−−−−−−KE−−−−−−−−−−−−−−−−G−−AFYITF−−SNVTELLS−−−−−−−−−−−−−−−−−−−−−−−−−−−−ENDDIIEIVGNIFENEMLLEVMR
fig|452948.4.peg.2830   Staphylococcus aureus 930918-3     MMLKF−−−−−−−−KAWDK−−−−DKKVM−−−−−−−−−−SIIDEIDFNSGYI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LISTGYKS−−−FNEV−−−KLLQY−−−TGFK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DVHGVEIYEGD−−−−−IVQD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−CYSREVS−−−FIEF−−−−−−KE−−−−−−−−−−−−−−−−G−−AFYITF−−SNVTELLS−−−−−−−−−−−−−−−−−−−−−−−−−−−−ENDDIIEIVGNIFENEMLLEVMR
fig|553577.3.peg.2693   Staphylococcus aureus A8796     MMLKF−−−−−−−−KAWDK−−−−DKKVM−−−−−−−−−−SIIDEIDFNSGYI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LISTGYKS−−−FNEV−−−KLLQY−−−TGFK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DVHGVEIYEGD−−−−−IVQD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−CYSREVS−−−FIEF−−−−−−KE−−−−−−−−−−−−−−−−G−−AFYITF−−SNVTELLS−−−−−−−−−−−−−−−−−−−−−−−−−−−−ENDDIIEIVGNIFENEMLLEVMR
fig|359787.11.peg.1098   Staphylococcus aureus subsp. aureus JH1     MMLKF−−−−−−−−KAWDK−−−−DKKVM−−−−−−−−−−SIIDEIDFNSGYI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LISTGYKS−−−FNEV−−−KLLQY−−−TGFK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DVHGVEIYEGD−−−−−IVQD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−CYSREVS−−−FIEF−−−−−−KE−−−−−−−−−−−−−−−−G−−AFYITF−−SNVTELLS−−−−−−−−−−−−−−−−−−−−−−−−−−−−ENDDIIEIVGNIFENEMLLEVMR
fig|526218.6.peg.859   Sebaldella termitidis ATCC 33386      MDKL−−−−−−−−RVWIE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KKKLLGEVREVNYIDKIVWVVGQWGGFR−−−SEDA−−−IFMKP−−−LMKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DITGKDIFEGD−−−−−IIQF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−HDNDGNAGRMIVKY−−−−−−GELEHMVLSKYNQTLKKVKMWGFYFEV−−SDEDKKVL−−−−−−−−−−−−−−−−−WRAENDDRTENDIEKEIKIVGNIYENK        
fig|526218.6.peg.2890   Sebaldella termitidis ATCC 33386      MDKL−−−−−−−−RVWIE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KKKLLGEVREVNYIDKIVWVVGQWGGFR−−−SEDA−−−IFMKP−−−LMKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DITGKDIFEGD−−−−−IIQF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−HDNDGNAGKMIVRY−−−−−−GELEHMVLSKYNQTLKKVKMWGFYFEA−−SDEDKKVL−−−−−−−−−−−−−−−−−WRAENDDRTENDIEKEIKIVGNIYENK        
fig|457390.3.peg.309   Bacteroides sp. 3_1_23                                                                                                                 MVF−−−TGKT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DCDDKEIWEGD−−−−−LIAL−−−−−−−−−−−−−−−−−−−−−−−−−DFPMFTGGASGKIIKC−−−VVVY−−−−−−DE−−−−−−−−−−−−−−−−TEAMFGLKPLEVKDNSATV−−−−−−−−−−−−−−−−−−−−−−−−−PFIGLKKEIKVLGNVYENSELI     
fig|527026.3.peg.4955   Bacillus thuringiensis serovar sotto str. T04001               DFYDDWIESFCIKDGRVHLGN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AVHHPGNQ−−−VNDA−−−ILMQY−−−TGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DVHGKGIYEGD−−−−−IVKN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AFGEEYKIVW−−−−−−DE−−−−−−−−−−−−−−−−KRCQFIAVT−−TIEDGSEW−−−−−−−−−−−−−−−−−−−−−−−−−−YQNVNRSLEVIGNIYEN         
fig|445337.5.peg.1555   Clostridium botulinum C str. Eklund       IKF−−−−−−−−RGYVIEELIGTQWV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TDGFGVGKTEYTDGTNSVYLSTPYGEYI−−−VDEK−−−SVGQY−−−TGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DIKGKEIYEGD−−−−−IVKV−−−−−−−−−−−−−−−−−−−−TIKYYTDCSKEKLDRKKVTIE−−−IVSF−−−−−−DY−−−−−−−−−−−−−−−−Y−−TFGLKE−−AKDDESIT−−−−−−−−−−−−−−−−−−−−−−PLLWLVSLEAKLEVIGNIYENPELLK    
fig|556259.3.peg.4218   Bacteroides sp. D2      TIKF−−−−−−−−RGKNL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YNNEWIFGDLIQYESGEMAIFSKKLSQYGCEATEMFNRSKVETT−−−TVGQF−−−TGLF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNGKEIYEGD−−−−−ILHT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ITFGFEPEEYTA−−−IILY−−−−−−−−−−−−−−−−−−−−−−−−DNCRFQLSN−−GRNLFYFG−−−−−−−−−−−−−−−−−−−−−−−−QSDLTKMDDTIVIGNIYDNPELI     
fig|619693.3.peg.631   Prevotella sp. oral taxon 472 str. F0295                                                                                                                         MK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DANGKEIYEGD−−−−−IIES−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−CGFRH−−−IVGY−−−−−−DA−−−−−−−−−−−−−−−−KQARFSAKN−−INGPRDDG−−−−−−−−−−−−−−−−−−−−−SSITQQWIDECEKVVIGNIYDNPELIK    
fig|679190.3.peg.1144   Prevotella buccalis ATCC 35310                 FRGWNK−−−−KNKRWLYGYYVVNGGEHFIAPGAF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VNDLAFYEDYVVEAD−−−SVGQY−−−TGIK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DAKGVKIFEGD−−−−−IIVN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QAYPY−−−IIQY−−−−−−HE−−−−−−−−−−−−−−−−EYSQFVAVP−−KPDVTIAF−−−−−−−−−−−−−−−−−−−−−−−−YQQWVNECGLVVIGNVHGKSELIK    
fig|351605.6.peg.3763   Geobacter uraniireducens Rf4                                                                                                                 MQF−−−TGHW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNGKEIYEGD−−−−−IVEA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VRQGQHVVC−−−EVRW−−−−−−GK−−−−−−−−−−−−−−−−ECAGFVLYR−−ESGGIRWN−−−−−−−−−−−−−−−−−−−−−LTGGDADSTEQSVEVIGNIYENANLL     
fig|309807.19.peg.1369   Salinibacter ruber DSM 13855     MWDGDEMIYVNDSAVWSL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KIEDSSDWTLHRKTRLHCRE−−−SPDT−−−SLMQH−−−IGLA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DAEGKQIFDGD−−−−−ILQD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GDGAVA−−−MVRW−−−−−−AS−−−−−−−−−−−−−−−−DAGGYVLLR−−ENGNPVGL−−−−−−−−−−−−−−−−−−−−−−−−SEANIQNGPWRVAGNLHETPNRIDPDLS
fig|323097.3.peg.420   Nitrobacter hamburgensis X14       IDTDERYISKSEGWYG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ENNRIEFS−−−LSDV−−−KPMQF−−−TGLR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNGTEIYEGD−−−−−IIHC−−−−−−−−−−−−−−−−−−−−−−−−TAGMHTLERNFQTDEKK−−−VITF−−−−−−DD−−−−−−−−−−−−−−−−G−−AFRYDG−−ITLGDMVN−−−−−−−−−−−−−−−−−−−−−−−−−−AHMSDYTFEIIGNIYENPELLK    
fig|411465.10.peg.15   Parvimonas micra ATCC 33270       IKF−−−−−−−−QAWLGHAMVQVVKLNFMKNVVGEYVRTGEGYFLDGKN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KGIHTGFV−−−MSKV−−−KLREY−−−TGLH−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNGREIYEGD−−−−−IIVN−−−−GSIPGPGYGISGLMLTKY−−−−−−−−−−−−−−−−−−−−−−EVKM−−−−−−VN−−−−−−−−−−−−−−−−G−−CFVVEC−−IPDCVDDH−−−−−−−−−−−−−−−VFGNCHLLYDMGFETRNIVEVIGNIYENPELLE    
fig|526982.3.peg.3725   Bacillus cereus Rock1-15         F−−−−−−−−RAWDL−−−−KDKRMYYNVGIVGTLIILEHEQSGYEFCEL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ELKSYDHI−−−DNNY−−−VLMQY−−−SGIK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DVEGTKIFEGD−−−−−MVRI−−−−−−−−−−−−−−−−−−−−−−−−−−−−FVPNDPEVKEYTS−−−TVFE−−−−−−LE−−−−−−−−−−−−−−−−G−−ALVVKM−−VGFDIYQD−−−−−−−−−−−−−−−−−−−−−DHCVGWVPEDYELKVIENIYENKN       
fig|488537.5.peg.2155   Clostridium perfringens D str. JGS1721                                                                         KKFVPVVNIDFSHMYITIKDGDELLTDT−−−SDMF−−−LLRQY−−−TGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKKGNKIYERD−−−−−TIDI−−−−−−−−−−−−−−−−−−−−−−−−−−−−RSLRDFNIKESEN−−−IVYF−−−−−−QD−−−−−−−−−−−−−−−−G−−MFKVGK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VP−−−−LSSINKACEI      
fig|488537.5.peg.2960   Clostridium perfringens D str. JGS1721                                                                         KKFVPVVNIDFSHMYITIKDGDELLTDT−−−SDMF−−−LLRQY−−−TGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKKGNKIYERD−−−−−TIDI−−−−−−−−−−−−−−−−−−−−−−−−−−−−RSLRDFNIKESEN−−−IVYF−−−−−−QD−−−−−−−−−−−−−−−−G−−MFKVGK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VP−−−−LSSINKACEI      
fig|488537.5.peg.3532   Clostridium perfringens D str. JGS1721                                                                         KKFVPVVNIDFSHMYITIKDGDELLTDT−−−SDMF−−−LLRQY−−−TGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKKGNKIYERD−−−−−TIDI−−−−−−−−−−−−−−−−−−−−−−−−−−−−RSLRDFNIKESEN−−−IVYF−−−−−−QD−−−−−−−−−−−−−−−−G−−MFKVGK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VP−−−−LSSINKACEI      
fig|488537.5.peg.686   Clostridium perfringens D str. JGS1721                                                                         KKFVPVVNIDFSHMYITIKDGDELLTDT−−−SDMF−−−LLRQY−−−TGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKKGNKIYERD−−−−−TIDI−−−−−−−−−−−−−−−−−−−−−−−−−−−−RSLRDFNIKESEN−−−IVYF−−−−−−QD−−−−−−−−−−−−−−−−G−−MFKVGK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VP−−−−LSSINKACEI      
fig|488537.5.peg.901   Clostridium perfringens D str. JGS1721                                                                         KKFVPVVNIDFSHMYITIKDGDELLTDT−−−SDMF−−−LLRQY−−−TGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKKGNKIYERD−−−−−TIDI−−−−−−−−−−−−−−−−−−−−−−−−−−−−RSLRDFNIKESEN−−−IVYF−−−−−−QD−−−−−−−−−−−−−−−−G−−MFKVGK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VP−−−−LSSINKACEI      
fig|488537.5.peg.2359   Clostridium perfringens D str. JGS1721                                                                         KKFVPVVNIDFSHMYITVKDGDEFLTDT−−−SDMF−−−LLRQY−−−TGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKRGNKIYERD−−−−−TIDI−−−−−−−−−−−−−−−−−−−−−−−−−−−−KSIKSCKINESEN−−−VVYF−−−−−−QD−−−−−−−−−−−−−−−−G−−MFKVGE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IP−−−−LSSINKECEI      
fig|488537.5.peg.1024   Clostridium perfringens D str. JGS1721                                                                         KKFVPVVNIDFIHMYITIEDGDELLTDT−−−SDMF−−−LLRQY−−−TGVK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKKGNKIYERD−−−−−TIDI−−−−−−−−−−−−−−−−−−−−−−−−−−−−KSTKCSFLEEGEN−−−VVHF−−−−−−ED−−−−−−−−−−−−−−−−G−−MFKVGK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IP−−−−LSYINE          
fig|451707.4.peg.106   Bacillus cereus NVH0597-99       IKF−−−−−−−−KAYDGGAWIYSECISKDDDNTWWILDCE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−DEWLMCSEPRQY−−−TGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNGSEIYEGD−−−−−ILKI−−−−−−−−−−−−−−−−−−−−−−−−−−−−VSNFELREDVQSQ−−−AVTY−−−−−−EE−−−−−−−−−−−−−−−−G−−FFSTYE−−−−−−−−−−−−−−−−−−−−−−−−−−−WSLFELLRNRKDGKQTFEVIGNTYENSELLE    
fig|457412.4.peg.1107   Ruminococcus sp. 5_1_39BFAA                                                                                                                  EY−−−TGLT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNGKKIWEND−−−−−ILMR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−HGNSEDLVK−−−AVFG−−−−−−−−−−−−−−−−−−−−−−−−−−−EFGVRNIETGSIVDKVVGWHYEIIPTDTISRCEPLCYSMPLTKDYIDRCEMEVVGSIFDNPELLQ    
fig|478749.5.peg.2293   Bryantella formatexigens DSM 14469                                                                                                                  QY−−−TGKT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DRNGRKIWEND−−−−−ICII−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NGYGINEEDGYF−−−TVRW−−−−−−DD−−−−−−−−−−−−−−−−DDVMFVLSG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NGLIVGFGYLRSCECEVVGNVFDNPGLLEGSE
fig|476272.5.peg.2845   Blautia hydrogenotrophica DSM 10507                                                                                                                LCQY−−−TGLT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNGKRIWEND−−−−−IVEH−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EISSVLG−−−AVEW−−−−−YAE−−−−−−−−−−−−−−−−DYVGWWVND−−EYLGKQQF−−−−−−−−−−−−−−−−−−−−−−−−−−TDEMWDECVVIGNIFDNPELL     
fig|411470.6.peg.1915   Ruminococcus gnavus ATCC 29149                                                                                                                LCQY−−−TGLT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNDKKIWEND−−−−−ILRY−−−−−−−−−−−−−−−−−−−−SYDYDGSPFLKDGEEIKYRVG−−−AVFW−−−−−−SE−−−−−−−−−−−−−−−−WRGSWAVCG−−RGNKKCTN−−−−−−−−−−−−−−−−−−−−−NDVFKYNRNPNRTEVIGNIFDNPELLE−−−V
fig|306264.1.peg.1655   Campylobacter upsaliensis RM3195                                                                                                                   F−−−TGYK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKKGQKIYEND−−−−−IVLM−−−−−−−−−−−−−−−−−−−−−−−−TLNDYEKEKDTIYKKID−−−SVYY−−−−−−TK−−−−−−−−−−−−−−−−GKGFILSN−−VFDNKINL−−−−−−−−−−−−−−−−−−−−−−−−−DDDFCENCCEVIGNIHEDKDLL     
fig|683082.3.peg.523   Campylobacter jejuni subsp. jejuni 1336                                                                          VLTIEHSYESNYYGGDYDEYCKVKDFT−−−SCNY−−−EIELF−−−TGLY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNGNKIYEND−−−−−ILMN−−−−−−−−−−−−−−−−−−−−−−ELTEEIFYITRDDTYKMSE−−−IILY−−−−−−GK−−−−−−−−−−−−−−−−DYNGNLYRK−−−−−−−−−−−−−−−−−−−−−−−−−−RNTGGINLLKMFVSDKNMSVVGNIHENPELLEEGK
fig|527025.3.peg.1191   Bacillus thuringiensis serovar thuringiensis str. T01001                                                                                                                  QY−−−IGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKYGKKIYEGD−−−−−LFYW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RDTLR−−−QVVY−−−−−−RE−−−−−−−−−−−−−−−−DKAAFMAKR−−VQGKSNND−−−−−−−−−−−−−−−−−−−FYFYMWNLQDLLERVEVIGNTYENPEFL     
fig|541229.3.peg.6268   Bacillus thuringiensis serovar chinensis CT-43                                                                                                                  QY−−−IGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKYGKKIYEGD−−−−−LFYW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RDTLR−−−QVVY−−−−−−RE−−−−−−−−−−−−−−−−DKAAFMAKR−−VQGKSNND−−−−−−−−−−−−−−−−−−−FYFYMWNLQDLLERVEVIGNTYENPEFL     
fig|405531.7.peg.5749   Bacillus cereus G9842                                                                                                                  QY−−−IGQK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKYGKKIYEGD−−−−−LFYW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RNTLR−−−QVVY−−−−−−RE−−−−−−−−−−−−−−−−DKAAFMAKR−−VQGKSNND−−−−−−−−−−−−−−−−−−−FYFYMWNLQDLLERVEVIGNTYENPEFL     
fig|563008.3.peg.2633   Prevotella oris C735                                                                                                                  QY−−−TGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKAGKKIFEGD−−−−−ILEY−−−−−−−−−−−−−−−−−−−−−−−−−−−IGKRKDNMNKVYRR−−−KVVF−−−−−−HE−−−−−−−−−−−−−−−−G−−MFALLS−−KELQAYSA−−−−−−−−−−−−−−−−−−−−−LNYHCMEDGRSAWRVIGNIHDNPELIK    
fig|567106.3.peg.1703   Campylobacter jejuni subsp. jejuni IA3902                 FRVWDK−−−−DEKCF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LDPYAKSRAVVKNLPNEKLLNL−−−EIELF−−−TGIK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNGKKIFEGD−−−−−ILLY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KKNKKKYIF−−−KIFD−−−−−−−−−−−−−−−−−−−−−−−−GLSHFKEFLFLKYSFDKESQTIIQSPYSQVELSHKLDCDCNFHNKANEI−−−YFEVIGNIHENEEILKNTE
fig|306264.1.peg.1589   Campylobacter upsaliensis RM3195                 FRIWDS−−−−NTNKFIEFAISDNIRAI−−−−−−−−−PRK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SDDL−−−VLELW−−−SGYF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNGKKIYEGD−−−−−IIKY−−−−−−−−−−−−−−−−−VYVFNHTLLDKYMLKRLPKKVSIG−−−YVGI−−−−−−−D−−−−−−−−−−−−−−−−DFLGFRILK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NKELQCFMKDVTNIEIIGNMHENADLLKEQ
fig|683082.3.peg.522   Campylobacter jejuni subsp. jejuni 1336                 FRIWNN−−−−NSKTYEAGSIIESLGFITSVFNQLTYEKP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TIDY−−−EIELW−−−TGYF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNGNKIYEGD−−−−−VIKY−−−−−−−−−−−−−−−−−VYIFKHELLDKGMIKKLPKKVSIG−−−CVGI−−−−−−−D−−−−−−−−−−−−−−−−NFLGFRILK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NKELQCFMKDIANIEIIGNIHENADLLKEGK
fig|683082.3.peg.525   Campylobacter jejuni subsp. jejuni 1336                                                                                            DYPLYQYGD−−−SADV−−−EVELF−−−TGFH−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNDTKIYEGD−−−−−ILRI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QLDYNKVEKG−−−FVQY−−−−−−HN−−−−−−−−−−−−−−−−G−−IFKVIN−−RKASHEYC−−−−−−−−−−−−−−−−−−−−−VTFLGICYIKDCVEIIGNIHENAELLK    
fig|889216.3.peg.1604   Campylobacter jejuni subsp. jejuni 51494                                                                                                         DRV−−−EIELF−−−TGFY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKKGNKIYEGD−−−−−ILYS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FEGCSEDEAFKY−−−KVVF−−−−−−KE−−−−−−−−−−−−−−−−G−−AFYLVE−−CGDDGEEW−−−−−−−−−−−−−−−−−−−−−DEDLLSEFCLEELEIVGNIHENAELLNENK
fig|360109.10.peg.1104   Campylobacter jejuni subsp. doylei 269.97                               INNDIVDINLSMGIND−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EIELF−−−TGLY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNGKKIYVGD−−−−−ILKY−−−−−−−−−−−−−−−−−−−−−−TRWCEQYMEDAEYSETIYE−−−IVCFDIKLGLYS−−−−−−−−−−−−KLLNGECGWFFEH−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FINDKNKTVEEMEIIGNIHENKELLK    
fig|360109.10.peg.292   Campylobacter jejuni subsp. doylei 269.97                  RIWDNGIFRYPIKINNDIVDINLDIGVNA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EIELF−−−TGLY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNGKKIYEGD−−−−−ILEY−−−−−−−−−−−−−−−−−−−−−−TRWCEQYMEDAEHSETIYE−−−IVCFDIRGGLYS−−−−−−−−−−−−KLLNGECGWFFEH−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FMNNKNNTIEEMSIIGNIHENKELLK    
fig|889216.3.peg.1684   Campylobacter jejuni subsp. jejuni 51494                 FRVWDK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−HHKGCGNKDCKCQTKYVYGEEAKTRLSEF−−−KEDC−−−EIELF−−−TGLY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKKGKKVYEND−−−−−IVKV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KSLYDYFLA−−−KISI−−−−−HKE−−−−−−−−−−−−−−−−G−−TFYFEG−−KNGDYIGS−−−−−−−−−−−−−−−−−−−−−−LIYLVEDEGYTIETIGNIHENPELLK    
fig|360111.3.peg.321   Campylobacter jejuni subsp. jejuni CF93-6                 FRVWDK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−HHKGCGNKDCKCQTKYVYGEEAKTRLSEF−−−KEDC−−−EIELF−−−TRLY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNGKKVYEND−−−−−IVKA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KNPFNYLEA−−−KISI−−−−−HKE−−−−−−−−−−−−−−−−G−−TFYLEN−−KSGHYMGS−−−−−−−−−−−−−−−−−−−−−−LIYLVEDEGYTIEIIGNIHENPELLK    
fig|541229.3.peg.6212   Bacillus thuringiensis serovar chinensis CT-43     MRYQF−−−−−−−−RVWNV−−−−MSKKMMGWREIFDLPAW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EIFPGTPE−−−QRPF−−−NVMQY−−−TGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNGKEIYEGD−−−−−ILKE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KDIVT−−−KVVF−−−−−−−−−−−−−−−−−−−−−−−−HDFRWQEKL−−ISSPRNHL−−−−−−−−−−−−−−−−−−−−KNYFPFRDTLPFTAVVIGNIYENPELLE    
fig|527025.3.peg.1136   Bacillus thuringiensis serovar thuringiensis str. T01001                                     IFDLPAW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EIFPGTPE−−−QRPF−−−NVMQY−−−TGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNGKEIYEGD−−−−−ILKE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KDIVT−−−KVVF−−−−−−−−−−−−−−−−−−−−−−−−HDFRWQEKL−−ISSPRNHL−−−−−−−−−−−−−−−−−−−−KNYFPFRDTLPFTAVVIGNIYENPELLE    
fig|527026.3.peg.4061   Bacillus thuringiensis serovar sotto str. T04001                               MMEWGEIFDLPAW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EIFPGTPE−−−QRPF−−−NVMQY−−−TGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNGKEIYEGD−−−−−IVSR−−−−−−−−−−−−−−−−−−−−−−−−−−HDGGIHFQEEPLAEH−−−IVKW−−−−−−−−−−−−−−−−−−−−−−−−GEFGWLPFN−−IGIGKSRC−−−−−−−−−−−−−−−−−−−−−−−−−−VYGEIFDFIVIGNIYENPELLEESK
fig|360105.8.peg.1909   Campylobacter curvus 525.92       IKF−−−−−−−−RAWDV−−−−LNKKMLNWGEVFHLPAW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EIFPGTPE−−−QRAF−−−EVMQY−−−TGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DRNGKEIYEGD−−−−−ILEF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RANPFDRKRDLF−−−QVVF−−−−−−KD−−−−−−−−−−−−−−−−G−−GFRDEW−−NNYIGQYL−−−−−−−−−−−−−−−−PPDIRNKQGGRVRLNEACEIIGNIYENPELLE−−EK
fig|718220.3.peg.5834   Bacillus cereus IS075       IKY−−−−−−−−RIYGK−−−−ENRIMYSWEEILNFDSLKDT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LKNGGKED−−−QYYS−−−PLLRY−−−TGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNGKEIYEGD−−−−−ILKE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KDIIT−−−KVVF−−−−−−−−−−−−−−−−−−−−−−−−HDYQWKEKL−−ISSPRNHL−−−−−−−−−−−−−−−−−−−−KNYFPFRDTLPFTAEVLGNIYENPELLK    
fig|315749.8.peg.3110   Bacillus cytotoxicus NVH 391-98       IKF−−−−−−−−RAWDN−−−−VKSEMYYVGEEGNISFGLDSNGIVAY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DITEGEEEFKVLHHL−−−QYMQY−−−TGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DHNGKEIYEGD−−−−−ILKE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SVEHGDIIT−−−QVVF−−−−−−−−−−−−−−−−−−−−−−−−KDYSWKEKL−−ISSPRNHL−−−−−−−−−−−−−−−−−−−−−−−RDYFPFGHVNVTVIGNIYENKELLE    
fig|315749.4.peg.3021   Bacillus cereus subsp. cytotoxis NVH 391-98       IKF−−−−−−−−RAWDN−−−−VKSEMYYVGEEGNISFGLDSNGIVAY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DITEGEEEFKVLHHL−−−QYMQY−−−TGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DHNGKEIYEGD−−−−−ILKE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SVEHGDIIT−−−QVVF−−−−−−−−−−−−−−−−−−−−−−−−KDYSWKEKL−−ISSPRNHL−−−−−−−−−−−−−−−−−−−−−−−RDYFPFGHVNVTVIGNIYENKELLE    
fig|1218175.3.peg.5353   Bacillus thuringiensis HD-771       IKF−−−−−−−−RVWDGNLMHNVSEL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−HFCMGPKLDGNGLKFYGPGVGQGWID−−−GENV−−−HLMQY−−−TGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNGKEIYEED−−−−−IVKL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LHAAHEENEIG−−−QIIY−−−−−−RG−−−−−−−−−−−−−−−−DEAAFRIFT−−NYLSERNL−−−−−−−−−−−−−−−−−−−−−−−−−−GSLVSSELEVVGNIYENPELMEESK
fig|527026.3.peg.3960   Bacillus thuringiensis serovar sotto str. T04001       IKF−−−−−−−−RVWDGNLMHNVSEL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−HFCMGPKLDGNGLKFYGPGVGQGWID−−−GENV−−−HLMQY−−−TGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNGKEIYEED−−−−−IVKL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LHAAHEENEIG−−−QIIY−−−−−−RG−−−−−−−−−−−−−−−−DEAAFRIFT−−NYLSERNL−−−−−−−−−−−−−−−−−−−−−−−−−−GSLVSSELEVVGNIYENPELMEESK
fig|642492.3.peg.3531   Clostridium lentocellum DSM 5427       IKF−−−−−−−−RGYNK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EFDGDQFVYGETILFQEYKQQWVMLIENELG−−−EQWVDIKEPQQY−−−TGLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNGKEIYEGD−−−−−IVKV−−−−−−−−−−−−−−−−−−−−−−−−−−KDNYIPGEVNIDING−−−EVKF−−−−−−KD−−−−−−−−−−−−−−−−A−−SFCISG−−SGITRYRWCDY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EIEVIGNIYENLDLLD    
fig|642492.3.peg.3759   Clostridium lentocellum DSM 5427       IKF−−−−−−−−RGYNK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EFDGDQFVYGETILFQEYKQQWVMLIENELG−−−EQWVDIKEPQQY−−−TGLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNGKEIYEGD−−−−−IVKV−−−−−−−−−−−−−−−−−−−−−−−−−−KDNYIPGEVNIDING−−−EVKF−−−−−−KD−−−−−−−−−−−−−−−−A−−SFCISG−−SGITRYRWCDY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EIEVIGNIYENLDLLD    
fig|642492.3.peg.3872   Clostridium lentocellum DSM 5427       IKF−−−−−−−−RGYNK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EFDGDQFVYGETILFQEYKQQWVMLIENELG−−−EQWVDIKEPQQY−−−TGLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNGKEIYEGD−−−−−IVKV−−−−−−−−−−−−−−−−−−−−−−−−−−KDNYIPGEVNIDING−−−EVKF−−−−−−KD−−−−−−−−−−−−−−−−A−−SFCISG−−SGITRYRWCDY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EIEVIGNIYENLDLLD    
fig|642492.3.peg.3944   Clostridium lentocellum DSM 5427       IKF−−−−−−−−RGYNK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EFDGDQFVYGETILFQEYKQQWVMLIENELG−−−EQWVDIKEPQQY−−−TGLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNGKEIYEGD−−−−−IVKV−−−−−−−−−−−−−−−−−−−−−−−−−−KDNYIPGEVNIDING−−−EVKF−−−−−−KD−−−−−−−−−−−−−−−−A−−SFCISG−−SGITRYRWCDY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EIEVIGNIYENLDLLD    
fig|1169253.3.peg.2011   Enterococcus faecalis T4                                                                                                                  QS−−−TGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNGVEIFEGD−−−−−ILKI−−−−−−−−−−−−−−−−−−−−−−−−−−−−IEVTNEGISEYIT−−−DVIW−−−−−−ED−−−−−−−−−−−−−−−−−−CSFVFKS−−EGVDYYDS−−−−−−−−−−−−−−−−FLGAFSGDPNKTYPLFELLVIGNVWDNLKLLERTE
fig|553209.3.peg.2201   Enterococcus faecalis TUSoD Ef11                                                                                                                  QS−−−TGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNGVEIFEGD−−−−−ILKI−−−−−−−−−−−−−−−−−−−−−−−−−−−−IEVTNEGISEYIT−−−DVIW−−−−−−ED−−−−−−−−−−−−−−−−−−CSFVFKS−−EGVDYYDS−−−−−−−−−−−−−−−−FLGAFSGDPNKTYPLFELLVIGNVWDNLKLLERTE
fig|536227.3.peg.4869   Clostridium carboxidivorans P7      EFKF−−−−−−−−KIWNGSTISKPFFI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−HDVKEYI−−−NEKC−−−EILQY−−−TGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNGREIYEGD−−−−−IIAI−−−−NNEKISLKLPIKFGKY−−−−−−−−−−−−−−SFSKYIGECGELSD−−−−−−ST−−−−−−−−−−−−−−−−DLYGFYVEN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EYLYIQMLNGNVIIVGNIYENLELI     
fig|324925.4.peg.2727   Pelodictyon phaeoclathratiforme BU-1                                                                                                               EWLQY−−−TGLD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKDGHEIFEGD−−−−−LLEW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKIIL−−−EVVF−−−−−−EA−−−−−−−−−−−−−−−−G−−SFRVLN−−EGDSDMLL−−−−−−−−−−−−−−−−−−−−−−−−−−−WFCLPDCKVIGNKYE          
fig|526984.3.peg.146   Bacillus cereus Rock3-29       IKF−−−−−−−−RAWDK−−−−VNKEMYRVGYI−−−−−−−−−−−DFPSKKVQLAIIQDGI−−−−−−−−−−−−−−−−−−−−−−−−−−−−CYKAFEAD−−−LKDV−−−ELLQY−−−TGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNGKEIYEGD−−−−−ILKG−−−−−−−−−−−−−−−−−−−−−−−−−−−PTLYETPENHSTTYCYWDVTY−−−−−−−−−−−−−−−−−−−−−−−−KNASFYLGD−−SAIEEDLD−−−−−−−−−−−−−−−−−−−−−−−−−−−−WILEECEVVGNVYENKNLLDGGE
fig|718220.3.peg.4153   Bacillus cereus IS075       IKY−−−−−−−−RIYGK−−−−ENRIMYSWEEILNFDSLKDT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LKNGGKED−−−QYYS−−−PLLPY−−−TGIK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNGKEIYVGD−−−−−ILKG−−−−−−−−−−−−−−−−−−−−−−−−−−−PTLYETPENTATTYSHWKVTY−−−−−−−−−−−−−−−−−−−−−−−−GNCSFYLGD−−SPIDEDID−−−−−−−−−−−−−−−−−−−−−−−−−−−−WVSEECEVVGNVYENPELL     
fig|451708.10.peg.2176   Bacillus cereus H3081.97       IKY−−−−−−−−RIYGK−−−−ENRIMYSWEEILNFDSLKDT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LKNGGKED−−−QYYS−−−PLLPY−−−TGIK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNGKEIYEGD−−−−−ILKG−−−−−−−−−−−−−−−−−−−−−−−−−−−PTLYETPENTATTYSHWKVTY−−−−−−−−−−−−−−−−−−−−−−−−GNCSFYLGD−−SPIDEDID−−−−−−−−−−−−−−−−−−−−−−−−−−−−WVSEECEVVGNVYENPELL     
fig|212717.8.peg.2230   Clostridium tetani E88        KF−−−−−−−−RAWDK−−−−ELNMM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VYTKEQTGHIEYNTNPADTINIILNQD−−−DYGY−−−VFMQY−−−TGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNEKEIYEGD−−−−−IIKK−−−−SNRSSNLY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EIIY−−−−−−QD−−−−−−−−−−−−−−−−SIACFRCKV−−IKGDIKSF−−−−−−−−−−−−−−−−−−−−−−−PCLNIGTVRNCEVIGNIYENPELLE−−−E
fig|526990.3.peg.5807   Bacillus cereus AH603       IKF−−−−−−−−RAWDK−−−−ESKRF−−−−−−−−−−IDWDNFIGNEHGNWLMTAFQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NEIY−−−HFQQY−−−TGIK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DSEGREIYDGD−−−−−ICKR−−−−−−−−−−−−−−−−−−−−−−−−−−−−NVWAFGEIRTFTG−−−QVKM−−−−−−FE−−−−−−−−−−−−−−−−G−−CWWIDS−−GTAAVPLW−−−−−−−−−−−−−−−−−−−−−−−−−−−−NEMHMLEIVGNIYENPELLE    
fig|451708.10.peg.2177   Bacillus cereus H3081.97        KF−−−−−−−−RAWDE−−−−ELKKM−−−−−−−−−−YSGDEIEGEDNLNAWLSYGELA−−−−−−−−−−−−−−−−−−−−−−−−−−−−IYRVDDGE−−−YTQL−−−KNLQY−−−AEIR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DSEGIEIYEGD−−−−−ICKR−−−−−−−−−−−−−−−−−−−−−−−−−−−−TVFAFGEPRKFVG−−−QVMM−−−−−−FE−−−−−−−−−−−−−−−−G−−CWWIDN−−GTAAVPLW−−−−−−−−−−−−−−−−−−−−−−−−−−−−NEMHILEIVGNIYENPELLK    
fig|718220.3.peg.1778   Bacillus cereus IS075        KF−−−−−−−−RAWDE−−−−ELKKM−−−−−−−−−−YSGDEIEGEDNLNAWLSYGELA−−−−−−−−−−−−−−−−−−−−−−−−−−−−IYRVDDGE−−−YTQL−−−KNLQY−−−AEIR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DSEGIEIYEGD−−−−−ICKR−−−−−−−−−−−−−−−−−−−−−−−−−−−−TVFAFGEPRKFVG−−−QVMM−−−−−−FE−−−−−−−−−−−−−−−−G−−CWWIDN−−GTAAVPLW−−−−−−−−−−−−−−−−−−−−−−−−−−−−NEMHILEIVGNIYENPELLK    
fig|718220.3.peg.4154   Bacillus cereus IS075        KF−−−−−−−−RAWDE−−−−ELKKM−−−−−−−−−−YSGDEIEGEDNLNAWLSYGELA−−−−−−−−−−−−−−−−−−−−−−−−−−−−IYRVDDGE−−−YTQL−−−KNLQY−−−AEIR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DSEGIEIYEGD−−−−−ICKR−−−−−−−−−−−−−−−−−−−−−−−−−−−−TVFAFGEPRKFVG−−−QVMM−−−−−−FE−−−−−−−−−−−−−−−−G−−CWWIDN−−GTAAVPLW−−−−−−−−−−−−−−−−−−−−−−−−−−−−NEMHILEIVGNIYENPELLK    
fig|718220.3.peg.6052   Bacillus cereus IS075        KF−−−−−−−−RAWDE−−−−ELKKM−−−−−−−−−−YSGDEIEGEDNLNAWLSYGELA−−−−−−−−−−−−−−−−−−−−−−−−−−−−IYRVDDGE−−−YTQL−−−KNLQY−−−AEIR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DSEGIEIYEGD−−−−−ICKR−−−−−−−−−−−−−−−−−−−−−−−−−−−−TVFAFGEPRKFVG−−−QVMM−−−−−−FE−−−−−−−−−−−−−−−−G−−CWWIDN−−GTAAVPLW−−−−−−−−−−−−−−−−−−−−−−−−−−−−NEMHILEIVGNIYENPELLK    
fig|451709.4.peg.5678   Bacillus cereus 03BB108        RY−−−−−−−−RVWDI−−−−RRKWM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LYNTESCGYVDYEMHPIAVINKILNGE−−−DKNL−−−KFMQV−−−TGFK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNDKEIFESDSDGQFIVKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GEFPVRDPETGKVIEIVH−−−−−−−−−−−−−−−−−−−−−−−−−−−GWYLDP−−IYKSIESR−−−−−−−−−−−−−−−−−−RWELPLNNYWVNKLGNGFDKNIYENPELL     
fig|1217737.3.peg.3064   Bacillus thuringiensis HD-789     MRYQF−−−−−−−−RVWNV−−−−MSKKMMGWGEIFDLPAW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EIFPGTPE−−−QRAF−−−NVMQY−−−TGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNGKEIYEGDSDGFYIVKN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GEFPVRCHETG−−−EIID−−−−−−−−−−−−−−−−−−−−−−−−RAHGWYLDP−−IDKSTEPS−−−−−−−−−−−−−−−−−−−SWEIPLNDFYINRLDAFDKNIYDNPELLE    
fig|527020.3.peg.1544   Bacillus thuringiensis IBL 4222     MRYQF−−−−−−−−RVWNV−−−−MSKKMMGWGEIFDLPAW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EIFPGTPE−−−QRAF−−−NVMQY−−−TGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNGKEIYEGDSDGFYIVKN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GEFPVRCHETG−−−EIID−−−−−−−−−−−−−−−−−−−−−−−−RAHGWYLDP−−IDKSTEPS−−−−−−−−−−−−−−−−−−−SWEIPLNDFYINRLDAFDKNIYDNPELLE    
fig|288681.12.peg.5931   Bacillus cereus E33L       IKF−−−−−−−−IAFDK−−−−VAGEIYNVGYI−−−−−−−−−−−DFANEVVQVAMIKD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EICYGTYVRRLKDV−−−VLLQY−−−TGKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNGKGIFEGDSDGFYIVKN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GEFPVRCHETC−−−EIID−−−−−−−−−−−−−−−−−−−−−−−−RAHGWYLDP−−IDKSTEPS−−−−−−−−−−−−−−−−−−−SWEIPLNDFYINRLDAFDKNIYDNPELLE    
fig|498214.7.peg.186   Clostridium botulinum A3 str. Loch Maree        KY−−−−−−−−RGCDT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ANGEWIYGNLCKNIKGNYGIQIEQGEFKWKF−−−VKTVDIESLGQY−−−TGFK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNYKEIYERD−−−−−IVKI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NGHKY−−−SVKF−−−−−−EI−−−−−−−−−−−−−−−−G−−SFMLVR−−CSDNTDMY−−−DQFENCWNDDVYPLSQFYWENDCEEDLIYQCEIIGNIYDNPELL     
fig|498214.7.peg.97   Clostridium botulinum A3 str. Loch Maree        KY−−−−−−−−RGCDT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ANGEWIYGNLCKNVKGNYGIQIEQGEFKWKF−−−VKTVDIESVGQY−−−TGFK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNYKEIYEGD−−−−−IVEI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GDFIY−−−FIKF−−−−−−EI−−−−−−−−−−−−−−−−G−−SFMLVR−−CSDETDMY−−−AEFDNCWNDDVYPLCQLHWESNADEDILYNCEVIGNIYNNP        
fig|526971.3.peg.5227   Bacillus cereus MM3                                                                                                                 MQS−−−TGLF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DQKEREIYESD−−−−−IVEI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NNKIY−−−GVKW−−−−−−DT−−−−−−−−−−−−−−−−GNAQFSLIR−−KGELHRNI−−−−−−−−−−−−−−−−−−−−−−−−−−−KELVNTCFVVGNSYENIELLE    
fig|321967.8.peg.1899   Lactobacillus casei ATCC 334     WDKVYECYLYDVQNAYDT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LSGCVKDENGEDAGYDEECFAGFLD−−−NDQY−−−VVEQY−−−TGLH−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNGRKIYEGD−−−−−IVKY−−−−−−−−−−−HMVRSYGDRYDPVTLGFIGTDWDVDADIIG−−−KVSI−−−−−−WP−−−−−−−−−−−−−−−−SNGVMMTNI−−ITDDPDMF−−−−−−−−−−−−−−−−−−CKKYPVPKRWHVTHDCEVIGNIFENPELLEGKQ
fig|526970.3.peg.1451   Bacillus cereus BGSC 6E1     MRIKV−−−−−−−−RFWDK−−−−ANKRFWLGGQEGESIDKETFQTYFKDGVLTGAMLEDVSYGFKTVDDTW−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EREL−−−PCSQY−−−TGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKEGNGIYEGD−−−−−ILEC−−−−−−−−−−−−−−−−−−−−TSELLTNFGKTKTGRYETTYK−−−QVIW−−−−−−LT−−−−−−−−−−−−−−−−DSWGYKVLK−−−−−−−−−−−−−−−−−−−−−−−−SNYIVEGAERKGLEVAIKFGVVCGNIYENSELLQ    
fig|1053228.3.peg.4332   Bacillus cereus VD102       IKF−−−−−−−−RAWDK−−−−VYKHFHEGDLIRD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YHIGEFID−−−NPEY−−−EVTQY−−−TGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNGTDIYEGD−−−−−IVKA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WSTGSYGTF−−−EVRW−−−−−RQD−−−−−−−−−−−−−−−−GSPCFILYP−−AFQHGEMW−−−−−−−−−−−−−−−−−−RLHGVKDKDGNYYDDVEVVGNIYENPELIK    
fig|527032.3.peg.1707   Bacillus thuringiensis serovar andalousiensis BGSC 4AW1       IKF−−−−−−−−RAWDK−−−−AYKQFQEGDIIRD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YIIGEFVD−−−DPEF−−−EVNQY−−−TGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNGKEIYEGD−−−−−IVRV−−−−−−−−−−−−WEQDSYTPNRDSGGGIVDYDCEEGFSQLG−−−VVSF−−−−−−QG−−−−−−−−−−−−−−−−−−−AWYTYE−−TKKHLAGR−−−−−−−−−−−−−−−−−−−−KEQIYAPLDFTDDLFVVGNIYESPELLQ    
fig|411154.5.peg.2346   Gramella forsetii KT0803       IKFRGKSLITKKWKY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GSLIDANPLGQYIVEFIKETDDSNYFP−−−VKKD−−−TVSQF−−−TGFK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DRNAKEIFEGD−−−−−ILSD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WTETDEGNIQSKMQVFW−−−−−−CE−−−−−−−−−−−−−−−−KIGAWKLDN−−SFKQDKSI−−−−−−−−−−−−−−−−−−−−−GDLLSDELANFTYEITANIYE          
fig|457391.3.peg.4182   Bacteroides sp. 3_1_33FAA                                                                                                                  QF−−−TGLR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNGQEIYEGD−−−−−IVQL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DYITTLGKHRIGLSFEVKW−−−−−−CT−−−−−−−−−−−−−−−−QEGCWVGWD−−GFVENTLQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−QTHKMFVVKGNIYDNPELLK    
fig|411154.5.peg.2314   Gramella forsetii KT0803                 FRAYNP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IVDRFQQFSLQDIEKKKDQIQ−−−WHIL−−−KIDQY−−−TGLR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DSKGRKIFEND−−−−−IVEF−−−−−−−−−−−−−−−−−−−−−SCERYYDSDPKVPTTKTFIS−−−QVKY−−−−−−IE−−−−−−−−−−−−−−−−A−−AFIISE−−TQEDDTFL−−−−−−−−−−−−−−−−−−−−−−−−−−−CAFNNECIIKGNIHRNKELLE    
fig|486408.6.peg.2027   Lactobacillus rhamnosus HN001       IKF−−−−−−−−RAWNK−−−−KDKVM−−−−−−−−−−VDVAAMNFGPSGLWSLIED−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AYDAELQL−−−ADSY−−−ELMQY−−−TGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNGREIYEGD−−−−−ILKV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TSEDWESYVA−−−TVKW−−−−FGKE−−−−−−−−−−−−−−−−DYPAFDLEG−−IPTSWSYD−−−−−−−−−−−−−−−−−−−ANALATIFQEGVETCEVIGNIFEDKQLLEGKQ
fig|525337.3.peg.493   Lactobacillus paracasei subsp. paracasei ATCC 25302                                                                                                   PD−−−LNDA−−−VLMEY−−−TGLH−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNGREIYDSD−−−−−ILKV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TGEDGESYVA−−−TVKW−−−−FGDE−−−−−−−−−−−−−−−−DYPAFDLEG−−IPAAWNYD−−−−−−−−−−−−−−−−−−−ANALATIFQSGVETCEVIGNIFENPELLEGKQ
fig|568704.3.peg.785   Lactobacillus rhamnosus Lc 705       IKF−−−−−−−−RAWNK−−−−KDKVM−−−−−−−−−−VDVAAMNFGPSGLWSLIED−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ADDAELQL−−−ADNY−−−ELMQY−−−TGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNGREIYEGD−−−−−IVRT−−−−−−−−−−−−−−−−−−−−−−−−−−−−GEDNIGDPDPTIG−−−QVIM−−−−−−RE−−−−−−−−−−−−−−−−G−−SWLIEN−−EKKQEEIG−−−−−−−−−−−−−−−−−−−−−−−−−−LFSEITSREVIGNIFEDNQLLE    
fig|536233.3.peg.1499   Clostridium botulinum E1 str. 'BoNT E Beluga'       IKF−−−−−−−−RAWDK−−−−FRLKM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YSVSSLVQDANLFSVGGVGPHIISKDGNLVL−−−LSEI−−−ELMQY−−−TGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKNGIEIYEGD−−−−−IYKN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−CEGLIM−−−TVIW−−−−−−KN−−−−−−−−−−−−−−−−NSSGFVFEY−−KFKRIYQG−−−−−−−−−−−−−EIYIDTNYIRLGDTSSKRWGGEVIGNIYENPNLLKEEE
fig|431943.8.peg.1979   Clostridium kluyveri DSM 555       LKF−−−−−−−−RAWDK−−−−QNKSMEEVELLGDEVLR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IKHAEWEN−−−REDF−−−EVMQY−−−TGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKKGVEIYEGD−−−−−IIEI−−−−−−−−−−−−−−−−−−−−−−−−−VNNLNEVTKKTNTHNA−−−IVKY−−−−−−KE−−−−−−−−−−−−−−−−G−−SLVATWQDEFVGEIFN−−−−−−−−−−−−−−−−−−−−−−YFNSYNTPIVTFEVIGNIYENPRLLKEGE
fig|431943.8.peg.2085   Clostridium kluyveri DSM 555       LKF−−−−−−−−RAWDK−−−−QNKSMEEVELLGDEVLR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IKHAEWEN−−−REDF−−−EVMQY−−−TGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DKKGVEIYEGD−−−−−IIEI−−−−−−−−−−−−−−−−−−−−−−−−−VNNLNEVTKKTNTHNA−−−IVKY−−−−−−KE−−−−−−−−−−−−−−−−G−−SLVATWQDEFVGEIFN−−−−−−−−−−−−−−−−−−−−−−YFNSYNTPIVTFEVIGNIYENPRLLKEGE
fig|592026.3.peg.610   Catonella morbi ATCC 51271                                                                                                         DGI−−−ELMQS−−−TGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DCDGQELFDGD−−−−−IIEF−−−−−−−−−−−−−−−−DDTICYEDESYGETNEVTGGECDIKNLAVVKI−−−−−−KE−−−−−−−−−−−−−−−−G−−LEMILE−−−−−−−DYKYGGDLSEDSASELLACIYAEYIDLNEFLSNPTNFKIVGNVYQNKDLLEVKE
fig|499175.4.peg.2908   Clostridium difficile ATCC 43255     MELKF−−−−−−−−REWNK−−−−NGKEM−−−−−−−−−−YSYDEMVCYSKNLLREWVY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SGVYLPTS−−−NENF−−−EVMIY−−−TGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DCIRKEIYEGD−−−−−IVSY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ILSFEEFIG−−−EVKF−−−−−−EE−−−−−−−−−−−−−−−−G−−FFVIDN−−EVLGECVG−−−−−−−−−−−−−−−−−−−−−−−−−−LFHEIAVVKVIGNIYENPEMLEKIR
fig|499175.4.peg.3570   Clostridium difficile ATCC 43255     MELKF−−−−−−−−REWNK−−−−NGKEM−−−−−−−−−−YSYDEMVCYSKNLLREVY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SGVYLPKN−−−NENF−−−EVMIY−−−TGLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DCDGKEIYEGD−−−−−IVLC−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RSIFFTEFAG−−−EVKF−−−−−−KD−−−−−−−−−−−−−−−−G−−CFIAVN−−EMSGDCFR−−−−−−−−−−−−−−−−−−−−−−−−−−−LSELAIVKIDGNIYED         
fig|556263.3.peg.560   Fusobacterium sp. D12        KF−−−−−−−−RAWDT−−−−RYRCM−−−−−−−−−−FTPEKIDFYNFTLQIEEGCI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WDSWDPDG−−−NEQV−−−ILMQY−−−TGMM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DHIGREIFEGD−−−−−IVRM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RSMTPGAPSIVG−−−EVQF−−−−−−EE−−−−−−−−−−−−−−−−S−−CYWVVN−−EKQQKGVC−−−−−−−−−−−−−−−−−−−−−−−−−−LFQEGVYIEILGNVFENLELLKEFR
fig|469605.3.peg.928   Fusobacterium sp. 3_1_5R       IKF−−−−−−−−RAFLK−−−−KDKCI−−−−−−−−−−CKVLAVELNKGLDGTLQVEY−−−−−−−−P−−−−−−−−−−−−−−−−−−−−−DGAKITLN−−−LCSV−−−ELMQY−−−TGMQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DHKETEIYEGD−−−−−IVSM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EAMTPGASNIVG−−−EVQF−−−−−−LE−−−−−−−−−−−−−−−−C−−GYWVVR−−EKEKKAVC−−−−−−−−−−−−−−−−−−−−−−−−−−LFEEGVYIKKLGNIYENHELLEEK
fig|469605.7.peg.413   Fusobacterium gonidiaformans 3-1-5R       IKF−−−−−−−−RAFLK−−−−KDKCI−−−−−−−−−−CKVLAVELNKGLDGTLQVEY−−−−−−−−P−−−−−−−−−−−−−−−−−−−−−DGAKITLN−−−LCSV−−−ELMQY−−−TGMQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DHKETEIYEGD−−−−−IVSM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EAMTPGASNIVG−−−EVQF−−−−−−LE−−−−−−−−−−−−−−−−C−−GYWVVR−−EKEKKAVC−−−−−−−−−−−−−−−−−−−−−−−−−−LFEEGVYIKKLGNIYENHELLEEK
fig|508765.6.peg.2191   Clostridium botulinum B str. Eklund 17B      ILKF−−−−−−−−KIFDTKINKIIQNI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NCCIDVNGQGVQSFSNKGFIEGTIK−−−NKYL−−−IPLQY−−−TNKN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DIKGTEIYDGY−−−−−IIKR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EYEVLGGNDITG−−−VVKF−−−−−−DE−−−−−−−−−−−−−−−−C