(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00020258

fig|457421.5.peg.5363   Clostridiales bacterium 1_7_47FAA                                                                                 MDPDGR−−−−−−−−−−−−−−−−−A−−YGYG−−AE−−−−−−−YL−−−−−−−−−−−−D−−−K−−−IAEYAGWE−−−YE−−−−−−−YVQA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SW−−−−−−−−−−−−EE−−−−−−CLKM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−L−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−K−−−−T−−−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−EIELL−−−−−−−−L−−P−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AEYSEER−−−A−−−−−−−−KD−−−−−−YLFSSYECCFDFVALV−−−−−−−GRRTDNRLYYDD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YAGFD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GMRVGMI−−−−−−−−−−−−KG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NYLNGLFEE−−−−YAG−−−−−−−−−−−−−−−−−−−−−−SH−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GFTYETVLYDTGTKLLNA−−−−−−−−−−−−−L−−−−−DRE−−−−−−−−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−−D−−−AII−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−N−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NMEFNVN−−−−−QKLLAKIDYMPAY−−−−FIT−−−−−−−−−−−−−−−−−−−−−−−−−SVK−−−−−−RPDLM−−−−EQ−−−−−−−−−−−−−−−−−−−−−−−−L−−−−−−−D−−−QALKQV                                                                                       
fig|411902.9.peg.2570   Clostridium bolteae ATCC BAA-613                                                                                 IDQDGY−−−−−−−−−−−−−−−−−A−−IGYG−−AD−−−−−−−YL−−−−−−−−−−−−N−−−K−−−IAEYTGWE−−−YE−−−−−−−YIQA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PW−−−−−−−−−−−−GE−−−−−−CLDM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−L−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−R−−−−R−−−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−ELDLL−−−−−−−−L−−P−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AEYSEER−−−A−−−−−−−−ED−−−−−−FLFSSYECCFDFAALV−−−−−−−GRKSDERLYYDD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YHGFQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GIRVGMI−−−−−−−−−−−−KG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NFLNDLFAE−−−−YAE−−−−−−−−−−−−−−−−−−−−−−NH−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GFSYEAVYYDTGTQILEA−−−−−−−−−−−−−L−−−−−ERE−−−−−−−−−−D−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−−D−−−AII−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−N−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NMEYNMN−−−−−QKLLAKIDYMPAY−−−−FIT−−−−−−−−−−−−−−−−−−−−−−−−−SVD−−−−−−KPGLM−−−−VR−−−−−−−−−−−−−−−−−−−−−−−−L−−−−−−−N−−−KALKQI                                                                                       
fig|997893.5.peg.2097   Clostridium bolteae 90A5                                                                                 IDQDGY−−−−−−−−−−−−−−−−−A−−IGYG−−AD−−−−−−−YL−−−−−−−−−−−−N−−−K−−−IAEYTGWE−−−YE−−−−−−−YIQA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PW−−−−−−−−−−−−GE−−−−−−CLDM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−L−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−R−−−−R−−−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−ELDLL−−−−−−−−L−−P−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AEYSEER−−−A−−−−−−−−ED−−−−−−FLFSSYECCFDFAALV−−−−−−−GRKSDERLYYDD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YHGFQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GIRVGMI−−−−−−−−−−−−KG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NFLNDLFAE−−−−YAE−−−−−−−−−−−−−−−−−−−−−−NH−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GFSYEAVYYDTGTQILEA−−−−−−−−−−−−−L−−−−−ERE−−−−−−−−−−D−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−−D−−−AII−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−N−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NMEYNMN−−−−−QKLLAKIDYMPAY−−−−FIT−−−−−−−−−−−−−−−−−−−−−−−−−SVD−−−−−−KPGLM−−−−VR−−−−−−−−−−−−−−−−−−−−−−−−L−−−−−−−N−−−KALKQI                                                                                       
fig|411903.6.peg.549   Collinsella aerofaciens ATCC 25986                                                                                                                                                      GWR−−−YEY−−−−−−VSG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TF−−−−−−−−−−−−TE−−−−−−LMDM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−L−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−E−−−−A−−−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−EIDL−−−−−−−−M−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PNISYSEER−−−A−−−−−−−−QK−−−−−−LLFS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SNPEG−−−−−−−−−−−−−−TERYFIYAKPDRDDLAKGDP−−−−−−−−−−−−RA−−−−−−−−−−−−−−−−−−−−−−−−−−−−LQGLTIGCNPDVM−−−−−−−−−−−−−−−−−−−−−−−−−−−−QTFVGQQWLANEGITC−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TYKEIDTGGALFDA−−−−−−−−−−−−−L−−−−−ANN−−−−−−−−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−−D−−−AII−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−M−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ND−−−−−−−−−−−TTSSPS−−−−−−−−−−−−−−−−−AS−−−−−−−−−−−−−−−−PMFYIGS−−−SD−−−−−−−−−−−−−−YFFAVPK−−SR−−−−−−−−−−−−PDLM−−−−DD−−−−−−−−−−−−−−−−−−−−−−−−I−−−−−−−N−−−AAMSAI−−−A−−−−−RVNPRY                                                                        
fig|545696.5.peg.2229   Holdemania filiformis DSM 12042                                                                            DYAGFIEEDGA−−−−−−−−−−−−−−−−−GKYTGYG−−VE−−−−−−−LL−−−−−−−−−−−−E−−−R−−−ISRITGWR−−−YE−−−−−−−YVYG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DW−−−−−−−−−−−−QQ−−−−−−ILSQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−L−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−D−−−−E−−−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−SIDLI−−−−−−−−M−−T−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AQYTEER−−−A−−−−−−−−DQ−−−−−−FLFSQQPIGDELAVV−−−−−−−YAREDASVYYDD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SAAMD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GLRIGLL−−−−−−−−−−−−QG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SYQNQSWQD−−−−YAE−−−−−−−−−−−−−−−−−−−−−−KH−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GLNCPATEYKTENQLMEA−−−−−−−−−−−−−L−−−−−LSQ−−−−−−−−−−Q−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−−D−−−LIV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−S−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GLALHDE−−−−−AKVVLKLEPAPFY−−−−IIT−−−−−−−−−−−−−−−−−−−−−−−−−NSA−−−−−−RPDLM−−−−TQ−−−−−−−−−−−−−−−−−−−−−−−−I−−−−−−−D−−−EALAEM                                                                                       
fig|411461.4.peg.1246   Dorea formicigenerans ATCC 27755                                                                                   ADDS−−−−−−−−−−−−−−−−−AAKSGYS−−YE−−−−−−−YI−−−−−−−−−−−−Q−−−K−−−VASYTGWR−−−YQ−−−−−−−YVYG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EW−−−−−−−−−−−−KD−−−−−−LYEK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−L−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−K−−−−T−−−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−EIDLM−−−−−−−−A−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ISYDDDR−−−V−−−−−−−−NS−−−−−−MLFPEYEMINETFYIY−−−−−−−KDTDDTTIKFGN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IDSYA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GKKIGV−−−−−−−−−−−−−VN−−−−−−−−−−−−−−−−−−−−−−−−−−−−NDKRMMTALEDWAKEKQAD−−−−−−−−−−−−−−−−−−−−−−IQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IQYYDSLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−S−−−C−−−AAD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−F−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NQ−−−−−−−−−−−−−−−−−−−−−−−−−K−−−−NIDAFVSADNVASSYTGISPVEKIGKEAYY−−−−LCV−−−−−−−−−−−−−−−−−−−−−−−−−AKD−−−−−−REDLL−−−−DE−−−−−−−−−−−−−−−−−−−−−−−−L−−−−−−−N−−−RALSII−−−T−−−−−EQDTL                                                                         
fig|411485.10.peg.977   Faecalibacterium prausnitzii M21/2                                                                                  YVNEK−−−−−−−−−−−−−−−−−GARKGYG−−YE−−−−−−−LL−−−−−−−−−−−−E−−−T−−−LSGYTGWQ−−−FE−−−−−−−YVTC−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DW−−−−−−−−−−−−SD−−−−−−CFEK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−L−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−K−−−−N−−−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−EIDII−−−−−−−−G−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ISYTEDR−−−T−−−−−−−−QE−−−−−−MLFSDEPMGVEKYYLY−−−−−−−ADLSRADISASD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FKTLN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GKKIGVL−−−−−−−−−−−−MG−−−−−−−−−−−−−−−−−−−−−−−−−−−−TEPEVM−−LAEW−−EEKYG−−−−−−−−−−−−−−−−−−−−−−LK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TEHVNI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−S−−−N−−−NED−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KQ−−−−−−−−−−−−−−−−−−−−−−−−−KLANHEIDCFVSLEESFWAERGISTITRVGESGIY−−−−YAI−−−−−−−−−−−−−−−−−−−−−−−−−NKN−−−−−−RPDIK−−−−EE−−−−−−−−−−−−−−−−−−−−−−−−L−−−−−−−D−−−DAMRAL−−−D−−−−−E                                                                             
fig|702450.3.peg.1577   Turicibacter sp. PC909                                                                                     EQ−−−−−−−−−−−−−−−−−LQPSGYY−−HD−−−−−−−LM−−−−−−−−−−−−N−−−L−−−IANDLNLD−−−YE−−−−−−−YVDV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PI−−−−−−−−−−−−NQ−−−−−−ALDK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−L−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−K−−−−N−−−−−−−−−−−−−−−−−−−−−−K−−−−−−−−−−EIDLL−−−−−−−−F−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ISSTPKR−−−Q−−−−−−−−EE−−−−−−YLFSKYYININRVGLF−−−−−−−−−−TNHNIRYGD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LEALN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GMTIGFI−−−−−−−−−−−−EN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EQNYQRLLN−−−−MLE−−−−−−−−−−−−−−−−−−−−−−GK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NINVNLKIVDSYESTLNL−−−−−−−−−−−−−F−−−−−CHH−−−−−−−−−−Q−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−−D−−−AIL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−Y−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−S−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AEYTDLD−−−KKYRNIFEFSTGSFY−−−−IVT−−−−−−−−−−−−−−−−−−−−−−−−−NKE−−−−−−NKE                                                                                                                                         
fig|289380.15.peg.842   Clostridium perfringens SM101                                                                                                          PDGYY−−NE−−−−−−−IL−−−−−−−−−−−−E−−−L−−−ICNKINLN−−−YE−−−−−−−YVDC−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NI−−−−−−−−−−−−TN−−−−−−ALEK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−L−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−K−−−−S−−−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−EVDLV−−−−−−−−F−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ISKTPDR−−−E−−−−−−−−KD−−−−−−YEFTDHYINNDNFAIY−−−−−−−−−−TNKNIKNGD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LKALN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GLKMGFL−−−−−−−−−−−−KG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EENNEWILR−−−−FLK−−−−−−−−−−−−−−−−−−−−−−DK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GINVKLIDVYNYPEDEEY−−−−−−−−−−−−−L−−−−−HDN−−−−−−−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−−D−−−FII−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−N−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KRSNIDYENKNIKKIFEFSSGPVY−−−−IVS−−−−−−−−−−−−−−−−−−−−−−−−−RKG−−−−−−NKKLI−−−−ER−−−−−−−−−−−−−−−−−−−−−−−−I−−−−−−−N−−−SALGEI−−−E−−−−−DD                                                                            
fig|451755.5.peg.653   Clostridium perfringens E str. JGS1987                                                                                                                                                                                                                                                          ALEK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−L−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−K−−−−S−−−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−QIDLV−−−−−−−−F−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ISKTPDR−−−E−−−−−−−−KE−−−−−−YEFTDHYLNNDNFAIY−−−−−−−−−−TNKNIKNGD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LKALN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GLKMGFL−−−−−−−−−−−−KG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EENNEWILR−−−−LLK−−−−−−−−−−−−−−−−−−−−−−DK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GINVKPIDVSNYPEDEEY−−−−−−−−−−−−−L−−−−−YNN−−−−−−−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−−D−−−FVV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−N−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TRSNINYENKNIKKIFEFSSGPVY−−−−IVS−−−−−−−−−−−−−−−−−−−−−−−−−RKG−−−−−−NEKLI−−−−EG−−−−−−−−−−−−−−−−−−−−−−−−I−−−−−−−D−−−SVLGEL−−−E−−−−−EDGE                                                                          
fig|451756.6.peg.278   Clostridium perfringens CPE str. F4969                                                                                                                                                                                                                                                          ALEK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−L−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−K−−−−S−−−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−QIDLV−−−−−−−−F−−G−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ISKTPDR−−−E−−−−−−−−KE−−−−−−YEFTDHYLNNDNFAIY−−−−−−−−−−TNKNIKNGD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LKALN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GLKMGFL−−−−−−−−−−−−KG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EENNEWILR−−−−LLK−−−−−−−−−−−−−−−−−−−−−−DK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GINVKPIYVSNYPEDEEY−−−−−−−−−−−−−L−−−−−HDN−−−−−−−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−−D−−−FVV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−N−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TRSNINYENKNIKKIFEFSSGPVY−−−−IVS−−−−−−−−−−−−−−−−−−−−−−−−−RKG−−−−−−NEKLI−−−−EG−−−−−−−−−−−−−−−−−−−−−−−−I−−−−−−−D−−−SVLGEL−−−E−−−−−EDGE                                                                          
fig|572480.3.peg.1622   Arcobacter nitrofigilis DSM 7299                                                            SDLNWIPYSYYD−−−−−−−−−−−−−−N−−−−−−−−−−−−−−−−−KIPKGYI−−LD−−−−−−−YI−−−−−−−−−−−KL−−−IAK−−−−−KGN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FTPIFLPDEF−−−−−−−SN−−−−−−NIQK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−I−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−L−−−−−−−−−−KKLDVL−−−−−−−−S−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GVIYKKSRE−−−D−−−−−−−−F−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LLFTDIFLKQKLAIVTNSNSFELKDIKSLDN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KTIGMI−−−−−−−−−−−−KN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−WAITNLMEKNYPKIKIRYYNSLD−−−−−−−−−−−−−−−−−−−−−−−−−−−−EIFKD−−−−−−−−−−−−−I−−−−−KNQ−−−−−−−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−I−−−D−−−−AT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VQ−−−Y−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NLT−−−−−−−−−−−AKYYI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NTKYINTLKTSILPKIKGYDENIYLGVRKD−−−−−−RPDLV−−−−DR−−−−−−−−−−−−−−−−−−−−−−−−L−−−−−−−N−−−KAMKSI                                                                                       
fig|521045.3.peg.1788   Kosmotoga olearia TBF 19.5.1                        EKMGIEVEYIIMDDEQAERMVKL−−−GTADITDGLLRSEENEKYF−−−DFSQPY−−−−−−−LKETVNIYYHKMLSGIGSPRDLSGFT−−VA−−−−−−−VVRSEPFSNDLPKENINIQYY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DSCEEVIKAV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VEGK−−−−−−−−V−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KIFIMNDISASYYLIKYGIEDEFK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TSPSFLQNLYAAVKKG−−−−−−KKELL−−−−ET−−−−−−−−−−−−−−−−−−−−−−−−V−−−−−−−N−−−KGLKQI                                                                                       
fig|411902.9.peg.520   Clostridium bolteae ATCC BAA-613     TDENGTRHGIVVDYLNEIAKYTGWQYEYI−−−DTAAEDIIPEFLDGQYDLMGGTYYQPEFEQYFAYPDYNTGYNKSVLLVRRDDKSIKTYDW−−−−−−−KSMSGKT−−IG−−−−−−−V−−−−−−−−−−−−−−−−−−−Y−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ERAEENIRRLQAFLD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−L−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−N−−−−−−−−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−−−IDCT−−−−−−−−I−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RYFSKDQLVDGNLYQCLEDREVDMLLGN−−−N−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−A−−−DVKGNLR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VVAEFDSQPYYIVTTPD−−−−−−NQEVL−−−−DG−−−−−−−−−−−−−−−−−−−−−−−−M−−−−−−−N−−−MALGKI−−−VDS                                                                                 
fig|411490.6.peg.3382   Anaerostipes caccae DSM 14662                             EYEYV−−−PTTADTFIQDLADGKYDVLGGAYYAKELEPYFAYPKYSMGSSRAGLLCLKEDNRIKSYEL−−−−−−−NTLNGKT−−IG−−−−−−−V−−−−−−−−−−−−−−−−−−−Y−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EKADEKIRRLKDFLK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−I−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−N−−−−−−−−−−−−−−−−−−−−−−−−−−−N−−−−−−−−−−−−IKCR−−−−−−−−L−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KYYGPKDLSESGDLYKYLLNKEVDLLLGN−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−L−−−EENPDFR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LAASFDAQPYYLVTSPK−−−−−−NKEIL−−−−NG−−−−−−−−−−−−−−−−−−−−−−−−I−−−−−−−N−−−SALEKI−−−QD                                                                                  
fig|410291.13.peg.1314   Vibrio harveyi HY01                                                                                                                                                                                                                                                           LND−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−I−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−−−−NKIDGA−−−−−−−−V−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GFSKTPDRE−−−A−−−−−−−−R−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FIFSDPFFSSTIAV−−−−−−−−−−−WYRESS−−−−−−−−−−−−−−−Y−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RDPRELNWVCVV−−GTVYCQYLE−−−−−−−−−−−−−−DMGVTSVRQMESRV−−−−−−−−−−−−−N−−−−−AFE−−−−−−−−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−−R−−−SGR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ANALISTY−−−−−−−−−−−−VAINQYLDQNDIVNGSVDIPSWLNEEEVSFI−−−TSKS−−−−−−NQELV−−−−DR−−−−−−−−−−−−−−−−−−−−−−−−I−−−−−−−N−−−RIL                                                                                          
fig|673519.3.peg.5177   Vibrio harveyi 1DA3                                                                                                                                                                                                                                                           LND−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−I−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−S−−−−−−−−−−GKIDGA−−−−−−−−V−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GFSKTPERE−−−A−−−−−−−−R−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FIFSQPFFSSTVAV−−−−−−−−−−−WYRENS−−−−−−−−−−−−−−−Y−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RDPRELQWVCVV−−GSVYCEFLK−−−−−−−−−−−−−−DTGATNVREVPTRA−−−−−−−−−−−−−K−−−−−AFE−−−−−−−−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−−R−−−TGR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ANALISTY−−−−−−−−−−−−VAINQYLDQNDIVNGSVDIPSWLNEEDVSFI−−−TSKE−−−−−−NQALV−−−−DR−−−−−−−−−−−−−−−−−−−−−−−−I−−−−−−−D−−−RIL                                                                                          
fig|243365.1.peg.243   Chromobacterium violaceum ATCC 12472                                                                                                                                                                                     MRYTIRYLP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−P−−−−−−−−−−−−ER−−−−−−ALAA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−F−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−I−−−−−−−−−−−−−−−−−−−−−−−−−−−A−−−−−−−−−−GQFDG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DPNRG−−−P−−−−−−−−Q−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−F−−−QLFFPDAVRI−−−−EPHLRTAWYFAVSASPEVRPKSWEDLKRY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−HI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AFLRGLHGVDVMTRGVVLREMVPSHEACIRMAQIKRVDLCIVSSESADRR−−−−−−−−−−−−−−−−−−−−−KFE−−−−−−−−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GSQLYSTQF−−−−−−−−−−−−EHLNIYL−−−−−−−−−−−−−−WL−−−−−−−−−−−−SPN−−−−−−QRAAA−−−−DK−−−−−−−−−−−−−−−−−−−−−−−−L−−−−−−−T−−−RAMRGM−−−A−−−−−ASGEL                                                                         
fig|243365.4.peg.235   Chromobacterium violaceum ATCC 12472                                                                                                                                             AF−−−−−ARAG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MRYTIRYLP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−P−−−−−−−−−−−−ER−−−−−−ALAA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−F−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−I−−−−−−−−−−−−−−−−−−−−−−−−−−−A−−−−−−−−−−GQFDG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DPNRG−−−P−−−−−−−−Q−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−F−−−QLFFPDAVRI−−−−EPHLRTAWYFAVSASPEVRPKSWEDLKRY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−HI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AFLRGLHGVDVMTRGVVLREMVPSHEACIRMAQIKRVDLCIVSSESADRR−−−−−−−−−−−−−−−−−−−−−KFE−−−−−−−−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KY−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GSQLYSTQF−−−−−−−−−−−−EHLNIYL−−−−−−−−−−−−−−WL−−−−−−−−−−−−SPN−−−−−−QRAAA−−−−DK−−−−−−−−−−−−−−−−−−−−−−−−L−−−−−−−T−−−RAMRGM−−−A−−−−−ASGEL                                                                         
fig|596153.3.peg.1372   Alicycliphilus denitrificans BC                                                             SADAPPMSRYDEQ−−−−−−−−−−−−R−−−−−−−−−−−−−−−−−RTYTGIS−−VD−−−−−−−VW−−−−−−−−−−−CF−−−IAE−−−−−RLGLR−−−YE−−−−−−−LIPGR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DQTVA−−−−−−−−−−−−−−−−−−−−−−−−Q−−−−−−KILQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−Q−−−−−−−E−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−AADVF−−−−−−−−I−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PLSLQSERA−−−Q−−−−−−−−R−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GLFTLPYYESYYAVIARKGWRLP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IRDIVDLA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QYRVGVV−−−−−−−−−−−−RG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VALEPTLKEIVPPHQLFSFDETSS−−−−−−−−−−−−−−−−−−−−−−−−−−−AGLFL−−−−−−−−−−−−−A−−−−−LRD−−−−−−G−−−S−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−I−−−D−−−−VA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VF−−−N−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KSI−−−−−−−−−−−FAE−−KRYLHEYFDLEDVLTLYGNPRAYRFYFSPT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PQ−−−−−−HERVV−−−−AA−−−−−−−−−−−−−−−−−−−−−−−−F−−−−−−−D−−−RYLAAM−−−D                                                                                   
fig|264462.1.peg.1295   Bdellovibrio bacteriovorus HD100                                                              DDIPP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−K−−−−−−−IY−−−−−−−−−−−RE−−−GAE−−−−−LKGTY−−−IE−−−−−−−IIREV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−CKRMKVEPVFETYPW−−−−−−−−−−−−PR−−−−−−AVMM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−A−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−E−−−−−−−T−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−KVDAL−−−−−−−−F−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PPFETEERR−−−K−−−−−−−−V−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FHFPNEPVSQTRNLAFALKKRKVR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VKGLEDFK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GLTVGVN−−−−−−−−−−−−DR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YSYGPSFDE−−−FKKQLRLDHSTT−−−−−−−−−−−−−−−−−−−−−−−−−−−Q−−EM−−−−−−−−−−−−−L−−−−−VKKLKADNIK−−−R−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−−D−−−−VV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VA−−−S−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EEA−−−−−−−−−−−FWFLAKRLGYKDEFEQVFVVSENPSYVVFSKAAG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KD−−−−−−RAQLA−−−−ER−−−−−−−−−−−−−−−−−−−−−−−−F−−−−−−−N−−−TTLLQL−−−K−−−−−KEG                                                                           
fig|264462.9.peg.1297   Bdellovibrio bacteriovorus HD100                                                              DDIPP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−K−−−−−−−IY−−−−−−−−−−−RE−−−GAE−−−−−LKGTY−−−IE−−−−−−−IIREV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−CKRMKVEPVFETYPW−−−−−−−−−−−−PR−−−−−−AVMM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−A−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−E−−−−−−−T−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−KVDAL−−−−−−−−F−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PPFETEERR−−−K−−−−−−−−V−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FHFPNEPVSQTRNLAFALKKRKVR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VKGLEDFK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GLTVGVN−−−−−−−−−−−−DR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YSYGPSFDE−−−FKKQLRLDHSTT−−−−−−−−−−−−−−−−−−−−−−−−−−−Q−−EM−−−−−−−−−−−−−L−−−−−VKKLKADNIK−−−R−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−−D−−−−VV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VA−−−S−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EEA−−−−−−−−−−−FWFLAKRLGYKDEFEQVFVVSENPSYVVFSKAAG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KD−−−−−−RAQLA−−−−ER−−−−−−−−−−−−−−−−−−−−−−−−F−−−−−−−N−−−TTLLQL−−−K−−−−−KEG                                                                           
fig|523791.5.peg.2148   Kangiella koreensis DSM 16069                                                            GSEYYPPFESLSAD−−−−−−−−−−−−K−−−−−−−−−−−−−−−−−QPEGFI−−TD−−−−−−−IQ−−−−−−−−−−−YA−−−MSK−−−−−ADGTN−−−VE−−−−−−−V−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KLMR−−−−−−−−−−W−−−−−−−−−−−−ED−−−−−−ALQE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−Q−−−−−−−N−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−RADAV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ALIASKERS−−−E−−−−−−−−H−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YDFTEPFYYVAHGLFIHTNTKE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VDSLEDMQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GQKVAVV−−−−−−−−−−−−−K−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GAYAKSNIENANYDVELVLADSEL−−−−−−−−−−−−−−−−−−−−−−−−−−−ECLEL−−−−−−−−−−−−−V−−−−−SAK−−−EVYA−−−C−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−−E−−−−VI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IT−−−T−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KRLTEKYELN−−−VKLAGPPFWPRPYAFGV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KKG−−−−−−NTKLQ−−−−EE−−−−−−−−−−−−−−−−−−−−−−−−L−−−−−−−Q−−−NQLAQI−−−I−−−−−VDGTY                                                                         
fig|292414.1.peg.3101   Silicibacter sp. TM1040                                                                 PPFVSISED−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GTPGGFG−−VE−−−−−−−I−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LE−−−−−−SLAER−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−A−−−−GLKLR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YQRITDA−−−−−−−−EFGR−−−−−−GPR−−−Q−−−−−−−−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−−GVD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VMPMMAS−−NPTRR−−−A−−−−−−−−RMDF−−−−−−−−−TFP−−−V−−−−−−−−−−−−HRV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PFSIFT−−LH−−−−−−−−−−−−−−−−−−−−−−−E−−−−−−−−−AA−−−−−−−−−−IAPQGL−−−−−−DDL−−I−−−−−−−−−−−GLRVGVED−−−G−−−−−−−KNAA−−−−−−QLAEVHGGLTLSYHEG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KDGIM−−−−−NA−−−−LLQG−−−Q−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−−D−−−−AV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−L−−−AP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NSA−−−−−−−−−−−F−−−−−TSHLERNHLR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−D−−−KVL−−I−−−S−−−−−REPFYTSE                                                                      
fig|292414.10.peg.1915   Ruegeria sp. TM1040                                                                 PPFVSISED−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GTPGGFG−−VE−−−−−−−I−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LE−−−−−−SLAER−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−A−−−−GLKLR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YQRITDA−−−−−−−−EFGR−−−−−−GPR−−−Q−−−−−−−−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−−GVD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VMPMMAS−−NPTRR−−−A−−−−−−−−RMDF−−−−−−−−−TFP−−−V−−−−−−−−−−−−HRV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PFSIFT−−LH−−−−−−−−−−−−−−−−−−−−−−−E−−−−−−−−−AA−−−−−−−−−−IAPQGL−−−−−−DDL−−I−−−−−−−−−−−GLRVGVED−−−G−−−−−−−KNAA−−−−−−QLAEVHGGLTLSYHEG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KDGIM−−−−−NA−−−−LLQG−−−Q−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−−D−−−−AV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−L−−−AP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NSA−−−−−−−−−−−F−−−−−TSHLERNHLR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−D−−−KVL−−I−−−S−−−−−REPFYTSE                                                                      
fig|382245.13.peg.80   Aeromonas salmonicida subsp. salmonicida A449                                                                 PPLSFVDENG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NLHGVV−−AD−−−−−−−IS−−−−−−−−−−−QV−−−IRAK−−−−−LGIQ−−−VNI−−−−−−LPVS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TT−−−−−−−−−−−−LE−−−−−−QIAM−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−E−−−−S−−−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−NADL−−−−−−−−M−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IMTPNVERL−−−E−−−−−−−−KF−−−−−−IF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TRAFALDPLVYITHEDN−−−−−−−−−−−−−−−−−−−−−−KGVDPEALLRLSRVAW−−−−−−−−−−VNGYIA−−SIEARRKLKARDDVFFDRIDDAL−−−AC−−−−−−−−−−−−−V−−−−−ARK−−−−−−−−−−R−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−C−−−D−−−VIV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LPLRGAKFFI−−NSQFSDSLHI−−−AGELFNSKPIG−−−−−−−−−−−−−−−−−−−−ASFAALP−−SQ−−−−−−−−−−−−SELV−−−−AV−−−−−−−−−−−−−−−−−−−−−−−−L−−−−−−−D−−−KVLAHI                                                                                       
fig|380703.7.peg.59   Aeromonas hydrophila subsp. hydrophila ATCC 7966                                                                 PPLSFLDIND−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TLHGVV−−AD−−−−−−−LL−−−−−−−−−−−QV−−−LRAK−−−−−LGVE−−−IEV−−−−−−VPVK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TP−−−−−−−−−−−−GQ−−−−−−MLQL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−L−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−D−−−−G−−−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−QVDI−−−−−−−−A−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VLSPSEERR−−−S−−−−−−−−RY−−−−−−LF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SRAFVLDPLAYVVGVRH−−−−−−−−−−−−−−−−−−−−−−EATAPETLLKTGTVAI−−−−−−−−−−IKDFISEQAIEEEYGKLTTRK−−−FERIEDAL−−−RC−−−−−−−−−−−−−V−−−−−ASE−−−−−−−−−−T−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−C−−−D−−−VTV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LPLRVAKYYI−−NSKFPDSLLI−−−TGELFDSIPIG−−−−−−−−−−−−−−−−−−−−AAFAVSP−−KQ−−−−−−−−−−−−HMLR−−−−DI−−−−−−−−−−−−−−−−−−−−−−−−L−−−−−−−D−−−RVIAII                                                                                       
fig|380703.5.peg.58   Aeromonas hydrophila subsp. hydrophila ATCC 7966                                                                 PPLSFLDIND−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TLHGVV−−AD−−−−−−−LL−−−−−−−−−−−QV−−−LRAK−−−−−LGVE−−−IEV−−−−−−VPVK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TP−−−−−−−−−−−−GQ−−−−−−MLQL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−L−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−D−−−−G−−−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−QVDI−−−−−−−−A−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VLSPSEERR−−−S−−−−−−−−RY−−−−−−LF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SRAFVLDPLAYVVGVRH−−−−−−−−−−−−−−−−−−−−−−EATAPETLLKTGTVAI−−−−−−−−−−IKDFISEQAIEEEYGKLTTRK−−−FERIEDAL−−−RC−−−−−−−−−−−−−V−−−−−ASE−−−−−−−−−−T−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−C−−−D−−−VTV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LPLRVAKYYI−−NSKFPDSLLI−−−TGELFDSIPIG−−−−−−−−−−−−−−−−−−−−AAFAVSP−−KQ−−−−−−−−−−−−HMLR−−−−DI−−−−−−−−−−−−−−−−−−−−−−−−L−−−−−−−D−−−RVIAII                                                                                       
fig|404974.7.peg.3651   Vibrio cholerae AM-19226                                                                                                                                                                                                                                                                                                                                                                                                                        VS−−−−−−−−A−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IWMHSAER−−−E−−−−−−−−VD−−−−−−FFYS−−−−−−−−−−L−−−−−−−−−PVSQEEFV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FFYPV−−−−K−−−−−−−−KPFD−−−−−W−−−−−−−KTLSDLA−−−−−−−PYKLGGV−−−−−−−−−−−−LA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YSY−−−−−−−−−−−−−−−−−−−−−−GKELDALLDSGVLT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MER−−−−−DGLAAKNLEK−−−−−−−−−−−−−L−−−−−AKG−−−−−−−−−−R−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−−D−−−LVP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EK−−−−−−−−−−−−−−−−−−−−−−−−−HIGYYLINQQI−−−−−−−−−−PHLQDLITHHPT−−−PFLTNS−−−−−−−−−NYLLFPK−−QGARSQ−−−−−−−−ELLG−−−−M−−−−−−−−−−−−−−−−−−−−−−−−−F−−−−−−−N−−−HYLVQ                                                                                        
fig|404974.3.peg.3176   Vibrio cholerae AM-19226                                                                                                                                                                                                                                                                                                                                                                                                                        VS−−−−−−−−A−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IWMHSAER−−−E−−−−−−−−VD−−−−−−FFYS−−−−−−−−−−L−−−−−−−−−PVSQEEFV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FFYPV−−−−K−−−−−−−−KPFD−−−−−W−−−−−−−KTLSDLA−−−−−−−PYKLGGV−−−−−−−−−−−−LA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YSY−−−−−−−−−−−−−−−−−−−−−−GKELDALLDSGVLT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MER−−−−−DGLAAKNLEK−−−−−−−−−−−−−L−−−−−AKG−−−−−−−−−−R−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−−D−−−LVP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EK−−−−−−−−−−−−−−−−−−−−−−−−−HIGYYLINQQI−−−−−−−−−−PHLQDLITHHPT−−−PFLTNS−−−−−−−−−NYLLFPK−−QGARSQ−−−−−−−−ELLG−−−−M−−−−−−−−−−−−−−−−−−−−−−−−−F−−−−−−−N−−−HYLVQ                                                                                        
fig|404974.3.peg.1182   Vibrio cholerae AM-19226                                                           IASGEWPPFI−−−−−G−−−−−−−SDLP−−−−−−−−−−−−−−−−−N−−YGFV−−GE−−−−−−−II−−−−−−−−−−−TQ−−−AFTK−−−−−QGYQ−−−VE−−−−−−−FQFL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PW−−−−−−−−−−−−AR−−−−−−AYAE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−Q−−−−R−−−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−LYDAT−−−−−−−−A−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IWMHSAER−−−E−−−−−−−−VD−−−−−−FFYS−−−−−−−−−−L−−−−−−−−−PVSQEEFV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FFYPV−−−−K−−−−−−−−KPFD−−−−−W−−−−−−−KTLSDLA−−−−−−−PYKLGGV−−−−−−−−−−−−LA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YSY−−−−−−−−−−−−−−−−−−−−−−GKELDALLDSGVLT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MER−−−−−DGLAAKNLEK−−−−−−−−−−−−−L−−−−−AKG−−−−−−−−−−R−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−−D−−−LVP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EK−−−−−−−−−−−−−−−−−−−−−−−−−HIGYYLINQQI−−−−−−−−−−PHLQDLITHHPT−−−PFLTNS−−−−−−−−−NYLLFPK−−QGARSQ−−−−−−−−ELLG−−−−M−−−−−−−−−−−−−−−−−−−−−−−−−F−−−−−−−N−−−HYLVQ                                                                                        
fig|404974.7.peg.1887   Vibrio cholerae AM-19226                                                           IASGEWPPFI−−−−−G−−−−−−−SDLP−−−−−−−−−−−−−−−−−N−−YGFV−−GE−−−−−−−II−−−−−−−−−−−TQ−−−AFTK−−−−−QGYQ−−−VE−−−−−−−FQFL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PW−−−−−−−−−−−−AR−−−−−−AYAE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−Q−−−−R−−−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−LYDAT−−−−−−−−A−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IWMHSAER−−−E−−−−−−−−VD−−−−−−FFYS−−−−−−−−−−L−−−−−−−−−PVSQEEFV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FFYPV−−−−K−−−−−−−−KPFD−−−−−W−−−−−−−KTLSDLA−−−−−−−PYKLGGV−−−−−−−−−−−−LA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YSY−−−−−−−−−−−−−−−−−−−−−−GKELDALLDSGVLT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MER−−−−−DGLAAKNLEK−−−−−−−−−−−−−L−−−−−AKG−−−−−−−−−−R−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−−D−−−LVP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EK−−−−−−−−−−−−−−−−−−−−−−−−−HIGYYLINQQI−−−−−−−−−−PHLQDLITHHPT−−−PFLTNS−−−−−−−−−NYLLFPK−−QGARSQ−−−−−−−−ELLG−−−−M−−−−−−−−−−−−−−−−−−−−−−−−−F−−−−−−−N−−−HYLVQ                                                                                        
fig|412966.10.peg.1117   Vibrio cholerae 1587                                                           IASGEWPPFI−−−−−G−−−−−−−SDLP−−−−−−−−−−−−−−−−−N−−YGFV−−GE−−−−−−−II−−−−−−−−−−−TQ−−−AFTK−−−−−QGYQ−−−VE−−−−−−−FQFL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PW−−−−−−−−−−−−AR−−−−−−AYAE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−Q−−−−R−−−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−LYDAT−−−−−−−−A−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IWMHSAER−−−E−−−−−−−−VD−−−−−−FFYS−−−−−−−−−−L−−−−−−−−−PVSQEEFV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FFYPV−−−−K−−−−−−−−KPFD−−−−−W−−−−−−−KTLSDLA−−−−−−−PYKLGGV−−−−−−−−−−−−LA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YSY−−−−−−−−−−−−−−−−−−−−−−GKELDALLDSGVLT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MER−−−−−DGLAAKNLEK−−−−−−−−−−−−−L−−−−−AKG−−−−−−−−−−R−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−−D−−−LVP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EK−−−−−−−−−−−−−−−−−−−−−−−−−HIGYYLINQQI−−−−−−−−−−PHLQDFITHHPT−−−PFLTNS−−−−−−−−−NYLLFPK−−QGARSQ−−−−−−−−ELLG−−−−V−−−−−−−−−−−−−−−−−−−−−−−−−F−−−−−−−N−−−HYLVQ                                                                                        
fig|412966.3.peg.962   Vibrio cholerae 1587                                                           IASGEWPPFI−−−−−G−−−−−−−SDLP−−−−−−−−−−−−−−−−−N−−YGFV−−GE−−−−−−−II−−−−−−−−−−−TQ−−−AFTK−−−−−QGYQ−−−VE−−−−−−−FQFL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PW−−−−−−−−−−−−AR−−−−−−AYAE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−Q−−−−R−−−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−LYDAT−−−−−−−−A−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IWMHSAER−−−E−−−−−−−−VD−−−−−−FFYS−−−−−−−−−−L−−−−−−−−−PVSQEEFV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FFYPV−−−−K−−−−−−−−KPFD−−−−−W−−−−−−−KTLSDLA−−−−−−−PYKLGGV−−−−−−−−−−−−LA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YSY−−−−−−−−−−−−−−−−−−−−−−GKELDALLDSGVLT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MER−−−−−DGLAAKNLEK−−−−−−−−−−−−−L−−−−−AKG−−−−−−−−−−R−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−−D−−−LVP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EK−−−−−−−−−−−−−−−−−−−−−−−−−HIGYYLINQQI−−−−−−−−−−PHLQDFITHHPT−−−PFLTNS−−−−−−−−−NYLLFPK−−QGARSQ−−−−−−−−ELLG−−−−V−−−−−−−−−−−−−−−−−−−−−−−−−F−−−−−−−N−−−HYLVQ                                                                                        
fig|345075.15.peg.977   Vibrio cholerae V51                                                           IASGEWPPFI−−−−−G−−−−−−−SDLP−−−−−−−−−−−−−−−−−N−−YGFV−−GE−−−−−−−II−−−−−−−−−−−TQ−−−AFTK−−−−−QGYQ−−−VE−−−−−−−FQFL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PW−−−−−−−−−−−−AR−−−−−−AYAE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−Q−−−−R−−−−−−−−−−−−−−−−−−−−−−D−−−−−−−−−−LYDAT−−−−−−−−A−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IWMHSAER−−−E−−−−−−−−VD−−−−−−FFYS−−−−−−−−−−L−−−−−−−−−PVSQEEFV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FFYPV−−−−K−−−−−−−−KPFD−−−−−W−−−−−−−KTLSDLA−−−−−−−PYKLGGV−−−−−−−−−−−−LA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YSY−−−−−−−−−−−−−−−−−−−−−−GKELDALLDSGVLT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MER−−−−−DGLAAKNLEK−−−−−−−−−−−−−L−−−−−AKG−−−−−−−−−−R−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−−D−−−LVP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EK−−−−−−−−−−−−−−−−−−−−−−−−−HIGYYLINQQI−−−−−−−−−−PHLQDLITHHPT−−−PFLTNS−−−−−−−−−NYLLFPK−−QGARSQ−−−−−−−−ELLG−−−−V−−−−−−−−−−−−−−−−−−−−−−−−−F−−−−−−−N−−−HYLVQ                                                                                        
fig|1055325.3.peg.2974   Vibrio cholerae O1 str. Amazonia                                                           IASGEWPPFI−−−−−G−−−−−−−SDLP−−−−−−−−−−−−−−−−−N−−YGFV−−GE−−−−−−−II−−−−−−−−−−−TQ−−−AFTK−−−−−QGYQ−−−VE−−−−−−−FQFL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PW−−−−−−−−−−−−AR−−−−−−AYAE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−Q−−−−R−−−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−LYDAT−−−−−−−−A−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IWMHSAER−−−E−−−−−−−−VD−−−−−−FFYS−−−−−−−−−−L−−−−−−−−−PVSQEEFV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FFYPV−−−−K−−−−−−−−KPFD−−−−−W−−−−−−−KTLSDLA−−−−−−−PYKLGGV−−−−−−−−−−−−LA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YSY−−−−−−−−−−−−−−−−−−−−−−GKELDALLDSGVLT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MER−−−−−DGLAAKNLEK−−−−−−−−−−−−−L−−−−−AKG−−−−−−−−−−R−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−−D−−−LVP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EK−−−−−−−−−−−−−−−−−−−−−−−−−HIGYYLINQQI−−−−−−−−−−PHLQDLITHHPT−−−PFLTNS−−−−−−−−−NYLLFPK−−QGARSQ−−−−−−−−ELLG−−−−V−−−−−−−−−−−−−−−−−−−−−−−−−F−−−−−−−N−−−HYLVQ                                                                                        
fig|1095662.3.peg.2440   Vibrio cholerae O1 str. 116063                                                           IASGEWPPFI−−−−−G−−−−−−−SDLP−−−−−−−−−−−−−−−−−N−−YGFV−−GE−−−−−−−II−−−−−−−−−−−TQ−−−AFTK−−−−−QGYQ−−−VE−−−−−−−FQFL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PW−−−−−−−−−−−−AR−−−−−−AYAE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−Q−−−−R−−−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−LYDAT−−−−−−−−A−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IWMHSAER−−−E−−−−−−−−VD−−−−−−FFYS−−−−−−−−−−L−−−−−−−−−PVSQEEFV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FFYPV−−−−K−−−−−−−−KPFD−−−−−W−−−−−−−KTLSDLA−−−−−−−PYKLGGV−−−−−−−−−−−−LA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YSY−−−−−−−−−−−−−−−−−−−−−−GKELDALLDSGVLT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MER−−−−−DGLAAKNLEK−−−−−−−−−−−−−L−−−−−AKG−−−−−−−−−−R−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−−D−−−LVP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EK−−−−−−−−−−−−−−−−−−−−−−−−−HIGYYLINQQI−−−−−−−−−−PHLQDLITHHPT−−−PFLTNS−−−−−−−−−NYLLFPK−−QGARSQ−−−−−−−−ELLG−−−−V−−−−−−−−−−−−−−−−−−−−−−−−−F−−−−−−−N−−−HYLVQ                                                                                        
fig|412883.3.peg.1930   Vibrio cholerae MZO-3                                                           IASGEWPPFI−−−−−G−−−−−−−SDLP−−−−−−−−−−−−−−−−−N−−YGFV−−GE−−−−−−−II−−−−−−−−−−−TQ−−−AFTK−−−−−QGYQ−−−VE−−−−−−−FQFL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PW−−−−−−−−−−−−AR−−−−−−AYAE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−Q−−−−R−−−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−LYDAT−−−−−−−−A−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IWMHSAER−−−E−−−−−−−−VD−−−−−−FFYS−−−−−−−−−−L−−−−−−−−−PVSQEEFV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FFYPV−−−−K−−−−−−−−KPFD−−−−−W−−−−−−−KTLSDLA−−−−−−−PYKLGGV−−−−−−−−−−−−LA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YSY−−−−−−−−−−−−−−−−−−−−−−GKELDALLDSGVLT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MER−−−−−DGLAAKNLEK−−−−−−−−−−−−−L−−−−−AKG−−−−−−−−−−R−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−−D−−−LVP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EK−−−−−−−−−−−−−−−−−−−−−−−−−HIGYYLINQQI−−−−−−−−−−PHLQDLITHHPT−−−PFLTNS−−−−−−−−−NYLLFPK−−QGARSQ−−−−−−−−ELLG−−−−V−−−−−−−−−−−−−−−−−−−−−−−−−F−−−−−−−N−−−HYLVQ                                                                                        
fig|417397.11.peg.1452   Vibrio cholerae 623-39                                                           IASGEWPPFI−−−−−G−−−−−−−SDLP−−−−−−−−−−−−−−−−−N−−YGFV−−GE−−−−−−−II−−−−−−−−−−−TQ−−−AFTK−−−−−QGYQ−−−VE−−−−−−−FQFL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PW−−−−−−−−−−−−AR−−−−−−AYAE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−Q−−−−R−−−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−LYDAT−−−−−−−−A−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IWMHSAER−−−E−−−−−−−−VD−−−−−−FFYS−−−−−−−−−−L−−−−−−−−−PVSQEEFV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FFYPV−−−−K−−−−−−−−KPFD−−−−−W−−−−−−−KTLSDLA−−−−−−−PYKLGGV−−−−−−−−−−−−LA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YSY−−−−−−−−−−−−−−−−−−−−−−GKELDALLDSGVLT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MER−−−−−DGLAAKNLEK−−−−−−−−−−−−−L−−−−−AKG−−−−−−−−−−R−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−−D−−−LVP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EK−−−−−−−−−−−−−−−−−−−−−−−−−HIGYYLINQQI−−−−−−−−−−PHLQDLITHHPT−−−PFLTNS−−−−−−−−−NYLLFPK−−QGARSQ−−−−−−−−ELLG−−−−V−−−−−−−−−−−−−−−−−−−−−−−−−F−−−−−−−N−−−HYLVQ                                                                                        
fig|593590.3.peg.2676   Vibrio cholerae TMA 21                                                           IASGEWPPFI−−−−−G−−−−−−−SDLP−−−−−−−−−−−−−−−−−N−−YGFV−−GE−−−−−−−II−−−−−−−−−−−TQ−−−AFTK−−−−−QGYQ−−−VE−−−−−−−FQFL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PW−−−−−−−−−−−−AR−−−−−−AYAE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−Q−−−−R−−−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−LYDAT−−−−−−−−A−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IWMHSAER−−−E−−−−−−−−VD−−−−−−FFYS−−−−−−−−−−L−−−−−−−−−PVSQEEFV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FFYPV−−−−K−−−−−−−−KPFD−−−−−W−−−−−−−KTLSDLA−−−−−−−PYKLGGV−−−−−−−−−−−−LA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YSY−−−−−−−−−−−−−−−−−−−−−−GKELDALLDSGVLT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MER−−−−−DGLAAKNLEK−−−−−−−−−−−−−L−−−−−AKG−−−−−−−−−−R−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−−D−−−LVP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EK−−−−−−−−−−−−−−−−−−−−−−−−−HIGYYLINQQI−−−−−−−−−−PHLQDLITHHPT−−−PFLTNS−−−−−−−−−NYLLFPK−−QGARSQ−−−−−−−−ELLG−−−−V−−−−−−−−−−−−−−−−−−−−−−−−−F−−−−−−−N−−−HYLVQ                                                                                        
fig|88888881.3.peg.2861   Vibrio cholerae NRT36s                                                           IASGEWPPFI−−−−−G−−−−−−−SDLP−−−−−−−−−−−−−−−−−N−−YGFV−−GE−−−−−−−II−−−−−−−−−−−TQ−−−AFTK−−−−−QGYQ−−−VE−−−−−−−FQFL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PW−−−−−−−−−−−−AR−−−−−−AYAE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−Q−−−−R−−−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−LYDAT−−−−−−−−A−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IWMHSAER−−−E−−−−−−−−VD−−−−−−FFYS−−−−−−−−−−L−−−−−−−−−PVSQEEFV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FFYPV−−−−K−−−−−−−−KPFD−−−−−W−−−−−−−KTLSDLA−−−−−−−PYKLGGV−−−−−−−−−−−−LA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YSY−−−−−−−−−−−−−−−−−−−−−−GKELDALLDSGVLT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MER−−−−−DGLAAKNLEK−−−−−−−−−−−−−L−−−−−AKG−−−−−−−−−−R−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−−D−−−LVP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EK−−−−−−−−−−−−−−−−−−−−−−−−−HIGYYLINQQI−−−−−−−−−−PHLQDLITHHPT−−−PFLTNS−−−−−−−−−NYLLFPK−−QGARSQ−−−−−−−−ELLG−−−−V−−−−−−−−−−−−−−−−−−−−−−−−−F−−−−−−−N−−−HYLVQ                                                                                        
fig|417398.15.peg.1459   Vibrio cholerae MZO-2                                                           IASGEWPPFI−−−−−G−−−−−−−SDLP−−−−−−−−−−−−−−−−−N−−YGFV−−GE−−−−−−−II−−−−−−−−−−−TQ−−−AFTK−−−−−QGYQ−−−VE−−−−−−−FQFL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PW−−−−−−−−−−−−AR−−−−−−AYAE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−Q−−−−R−−−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−LYDAT−−−−−−−−A−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IWMHSAER−−−E−−−−−−−−VD−−−−−−FFYS−−−−−−−−−−L−−−−−−−−−PVSQEEFV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FFYPV−−−−K−−−−−−−−KPFD−−−−−W−−−−−−−KTLSDLA−−−−−−−PYKLGGV−−−−−−−−−−−−LA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YSY−−−−−−−−−−−−−−−−−−−−−−GKELDALLDSGVLT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MER−−−−−DGLAAKNLEK−−−−−−−−−−−−−L−−−−−AKG−−−−−−−−−−R−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−−D−−−LVP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EK−−−−−−−−−−−−−−−−−−−−−−−−−HIGYYLINQQI−−−−−−−−−−PHLQDLITHHPT−−−PFLTNS−−−−−−−−−NYLLFPK−−QGARSQ−−−−−−−−ELLG−−−−V−−−−−−−−−−−−−−−−−−−−−−−−−F−−−−−−−N−−−HYLVQ                                                                                        
fig|593585.3.peg.236   Vibrio cholerae bv. albensis VL426                                                           IASGEWPPFI−−−−−G−−−−−−−SDLP−−−−−−−−−−−−−−−−−N−−YGFV−−GE−−−−−−−II−−−−−−−−−−−TQ−−−AFAK−−−−−QGYQ−−−VE−−−−−−−FHFL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PW−−−−−−−−−−−−AR−−−−−−AYAE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−Q−−−−R−−−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−LYDAT−−−−−−−−A−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IWMHSAER−−−E−−−−−−−−VD−−−−−−FFYS−−−−−−−−−−L−−−−−−−−−PVSQEEFV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FFYAV−−−−K−−−−−−−−KPFD−−−−−W−−−−−−−KTLSDLA−−−−−−−PYKLGGV−−−−−−−−−−−−LA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YSY−−−−−−−−−−−−−−−−−−−−−−GKELDALLDSGVLT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MER−−−−−DGLAAKNLEK−−−−−−−−−−−−−L−−−−−AKG−−−−−−−−−−R−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−−D−−−LVP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EK−−−−−−−−−−−−−−−−−−−−−−−−−HIGYYLINQQI−−−−−−−−−−PHLQDLITHHPT−−−PFLTNS−−−−−−−−−NYLLFPK−−QGARSQ−−−−−−−−ELLD−−−−A−−−−−−−−−−−−−−−−−−−−−−−−−F−−−−−−−N−−−HYLVQ                                                                                        
fig|1225781.3.peg.2721   Vibrio cholerae VC35                                                           IASGEWPPFI−−−−−G−−−−−−−SDLP−−−−−−−−−−−−−−−−−N−−YGFV−−GE−−−−−−−II−−−−−−−−−−−TQ−−−AFTK−−−−−QGYQ−−−VE−−−−−−−FQFL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PW−−−−−−−−−−−−AR−−−−−−AYAE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−Q−−−−R−−−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−LYDAT−−−−−−−−A−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IWMHSAER−−−E−−−−−−−−VD−−−−−−FFYS−−−−−−−−−−L−−−−−−−−−PVSQEEFV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FFYPV−−−−K−−−−−−−−KPFD−−−−−W−−−−−−−KTLSDLA−−−−−−−PYKLGGV−−−−−−−−−−−−LA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YSY−−−−−−−−−−−−−−−−−−−−−−GKELDALLDSGVLT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MER−−−−−DGLAAKNLEK−−−−−−−−−−−−−L−−−−−AKG−−−−−−−−−−R−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−−D−−−LVP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EK−−−−−−−−−−−−−−−−−−−−−−−−−HIGYYLINQQI−−−−−−−−−−PHLQDLITHHPT−−−PFLTNS−−−−−−−−−NYLLFPK−−QSARSQ−−−−−−−−ELLG−−−−V−−−−−−−−−−−−−−−−−−−−−−−−−F−−−−−−−N−−−HYLVQ                                                                                        
fig|693743.7.peg.1046   Vibrio cholerae PS15                                                           IASGEWPPFI−−−−−G−−−−−−−SDLP−−−−−−−−−−−−−−−−−N−−YGFV−−GE−−−−−−−II−−−−−−−−−−−TQ−−−AFTK−−−−−QGYQ−−−VE−−−−−−−FQFL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PW−−−−−−−−−−−−AR−−−−−−AYAE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−Q−−−−R−−−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−LYDAT−−−−−−−−A−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IWMHSAER−−−E−−−−−−−−VD−−−−−−FFYS−−−−−−−−−−L−−−−−−−−−PVSQEEFV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FFYPV−−−−K−−−−−−−−KPFD−−−−−W−−−−−−−KTLSDLA−−−−−−−PYKLGGV−−−−−−−−−−−−LA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YSY−−−−−−−−−−−−−−−−−−−−−−GKELDALLDSGVLT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MER−−−−−DGLAAKNLEK−−−−−−−−−−−−−L−−−−−AKG−−−−−−−−−−R−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−−D−−−LVP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EK−−−−−−−−−−−−−−−−−−−−−−−−−HIGYYLINQQI−−−−−−−−−−PHLQDLITHHPT−−−PFLTNS−−−−−−−−−NYLLFPK−−QSARSQ−−−−−−−−ELLG−−−−V−−−−−−−−−−−−−−−−−−−−−−−−−F−−−−−−−N−−−HYLVQ                                                                                        
fig|345074.15.peg.858   Vibrio cholerae RC385                                                           IASGEWPPFI−−−−−G−−−−−−−SDLP−−−−−−−−−−−−−−−−−N−−YGFV−−GE−−−−−−−II−−−−−−−−−−−TQ−−−AFTK−−−−−QGYQ−−−VE−−−−−−−FQFL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PW−−−−−−−−−−−−AR−−−−−−AYAE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−Q−−−−R−−−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−LYDAT−−−−−−−−A−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IWMHSADR−−−E−−−−−−−−ID−−−−−−FFYS−−−−−−−−−−L−−−−−−−−−PVSQEEFV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FFYPV−−−−K−−−−−−−−KPFD−−−−−W−−−−−−−KTLSDLA−−−−−−−PYKLGGV−−−−−−−−−−−−LA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YSY−−−−−−−−−−−−−−−−−−−−−−GKELDALLDSGVLT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MER−−−−−DGLAAKNLEK−−−−−−−−−−−−−L−−−−−AKG−−−−−−−−−−R−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−−D−−−LVP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EK−−−−−−−−−−−−−−−−−−−−−−−−−HIGYYLINQQI−−−−−−−−−−PHLQDLITHHPT−−−PFLTNS−−−−−−−−−NYLLFPK−−QSARSQ−−−−−−−−ELLG−−−−V−−−−−−−−−−−−−−−−−−−−−−−−−F−−−−−−−N−−−HYLVQ                                                                                        
fig|991997.6.peg.2335   Vibrio cholerae BJG-01                                                           IASGEWPPFI−−−−−G−−−−−−−SDLP−−−−−−−−−−−−−−−−−N−−YGFV−−GE−−−−−−−II−−−−−−−−−−−TQ−−−AFTK−−−−−QGYQ−−−VE−−−−−−−FQFL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PW−−−−−−−−−−−−AR−−−−−−AYAE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−Q−−−−R−−−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−LYDAT−−−−−−−−A−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IWMHSADR−−−E−−−−−−−−ID−−−−−−FFYS−−−−−−−−−−L−−−−−−−−−PVSQEEFV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FFYPV−−−−K−−−−−−−−KPFD−−−−−W−−−−−−−KTLSDLA−−−−−−−PYKLGGV−−−−−−−−−−−−LA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YSY−−−−−−−−−−−−−−−−−−−−−−GKELDALLDSGVLT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MER−−−−−DGLAAKNLEK−−−−−−−−−−−−−L−−−−−AKG−−−−−−−−−−R−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−−D−−−LVP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EK−−−−−−−−−−−−−−−−−−−−−−−−−HIGYYLINQQI−−−−−−−−−−PHLQDLITHHPT−−−PFLTNS−−−−−−−−−NYLLFPK−−QSARSQ−−−−−−−−ELLG−−−−V−−−−−−−−−−−−−−−−−−−−−−−−−F−−−−−−−N−−−HYLVQ                                                                                        
fig|345072.3.peg.2793   Vibrio cholerae MO10                                                           IASGEWPPFI−−−−−G−−−−−−−SDLP−−−−−−−−−−−−−−−−−N−−YGFV−−GE−−−−−−−II−−−−−−−−−−−TQ−−−AFTK−−−−−QGYQ−−−VE−−−−−−−FQFL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PW−−−−−−−−−−−−AR−−−−−−AYAE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−Q−−−−R−−−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−LYDAT−−−−−−−−A−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IWMHSAER−−−E−−−−−−−−ID−−−−−−FFYS−−−−−−−−−−L−−−−−−−−−PVSQEEFV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FFYPV−−−−K−−−−−−−−KPFD−−−−−W−−−−−−−KTLSDLA−−−−−−−PYKLGGV−−−−−−−−−−−−LA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YSY−−−−−−−−−−−−−−−−−−−−−−GKELDALLDSGVLT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MER−−−−−DGLAAKNLEK−−−−−−−−−−−−−L−−−−−AKG−−−−−−−−−−R−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−−D−−−LVP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EK−−−−−−−−−−−−−−−−−−−−−−−−−HIGYYLINQQI−−−−−−−−−−PHLQDLITHHPT−−−PFLTNS−−−−−−−−−NYL                                                                                                                                                                
fig|1258564.3.peg.916   Vibrio cholerae P-18785                                                           IASGEWPPFI−−−−−G−−−−−−−SDLP−−−−−−−−−−−−−−−−−N−−YGFV−−GE−−−−−−−II−−−−−−−−−−−TQ−−−AFTK−−−−−QGYQ−−−VE−−−−−−−FQFL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PW−−−−−−−−−−−−AR−−−−−−AYAE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−Q−−−−R−−−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−LYDAT−−−−−−−−A−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IWMHSAER−−−E−−−−−−−−ID−−−−−−FFYS−−−−−−−−−−L−−−−−−−−−PVSQEEFV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FFYPV−−−−K−−−−−−−−KPFD−−−−−W−−−−−−−KTLSDLA−−−−−−−PYKLGGV−−−−−−−−−−−−LA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YSY−−−−−−−−−−−−−−−−−−−−−−GKELDALLDSGVLT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MER−−−−−DGLAAKNLEK−−−−−−−−−−−−−L−−−−−AKG−−−−−−−−−−R−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−−D−−−LVP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EK−−−−−−−−−−−−−−−−−−−−−−−−−HIGYYLINQQI−−−−−−−−−−PHLQDLITHHPT−−−PFLTNS−−−−−−−−−NYLLFPK−−QSARSQ−−−−−−−−ELLG−−−−V−−−−−−−−−−−−−−−−−−−−−−−−−F−−−−−−−N−−−HYLVQ                                                                                        
fig|345076.11.peg.2304   Vibrio cholerae V52                                                           IASGEWPPFI−−−−−G−−−−−−−SDLP−−−−−−−−−−−−−−−−−N−−YGFV−−GE−−−−−−−II−−−−−−−−−−−TQ−−−AFTK−−−−−QGYQ−−−VE−−−−−−−FQFL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PW−−−−−−−−−−−−AR−−−−−−AYAE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−Q−−−−R−−−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−LYDAT−−−−−−−−A−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IWMHSAER−−−E−−−−−−−−ID−−−−−−FFYS−−−−−−−−−−L−−−−−−−−−PVSQEEFV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FFYPV−−−−K−−−−−−−−KPFD−−−−−W−−−−−−−KTLSDLA−−−−−−−PYKLGGV−−−−−−−−−−−−LA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YSY−−−−−−−−−−−−−−−−−−−−−−GKELDALLDSGVLT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MER−−−−−DGLAAKNLEK−−−−−−−−−−−−−L−−−−−AKG−−−−−−−−−−R−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−−D−−−LVP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EK−−−−−−−−−−−−−−−−−−−−−−−−−HIGYYLINQQI−−−−−−−−−−PHLQDLITHHPT−−−PFLTNS−−−−−−−−−NYLLFPK−−QSARSQ−−−−−−−−ELLG−−−−V−−−−−−−−−−−−−−−−−−−−−−−−−F−−−−−−−N−−−HYLVQ                                                                                        
fig|412614.8.peg.2463   Vibrio cholerae 2740-80                                                           IASGEWPPFI−−−−−G−−−−−−−SDLP−−−−−−−−−−−−−−−−−N−−YGFV−−GE−−−−−−−II−−−−−−−−−−−TQ−−−AFTK−−−−−QGYQ−−−VE−−−−−−−FQFL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PW−−−−−−−−−−−−AR−−−−−−AYAE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−Q−−−−R−−−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−LYDAT−−−−−−−−A−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IWMHSAER−−−E−−−−−−−−ID−−−−−−FFYS−−−−−−−−−−L−−−−−−−−−PVSQEEFV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FFYPV−−−−K−−−−−−−−KPFD−−−−−W−−−−−−−KTLSDLA−−−−−−−PYKLGGV−−−−−−−−−−−−LA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YSY−−−−−−−−−−−−−−−−−−−−−−GKELDALLDSGVLT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MER−−−−−DGLAAKNLEK−−−−−−−−−−−−−L−−−−−AKG−−−−−−−−−−R−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−−D−−−LVP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EK−−−−−−−−−−−−−−−−−−−−−−−−−HIGYYLINQQI−−−−−−−−−−PHLQDLITHHPT−−−PFLTNS−−−−−−−−−NYLLFPK−−QSARSQ−−−−−−−−ELLG−−−−V−−−−−−−−−−−−−−−−−−−−−−−−−F−−−−−−−N−−−HYLVQ                                                                                        
fig|417399.11.peg.1029   Vibrio cholerae NCTC 8457                                                           IASGEWPPFI−−−−−G−−−−−−−SDLP−−−−−−−−−−−−−−−−−N−−YGFV−−GE−−−−−−−II−−−−−−−−−−−TQ−−−AFTK−−−−−QGYQ−−−VE−−−−−−−FQFL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PW−−−−−−−−−−−−AR−−−−−−AYAE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−Q−−−−R−−−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−LYDAT−−−−−−−−A−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IWMHSAER−−−E−−−−−−−−ID−−−−−−FFYS−−−−−−−−−−L−−−−−−−−−PVSQEEFV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FFYPV−−−−K−−−−−−−−KPFD−−−−−W−−−−−−−KTLSDLA−−−−−−−PYKLGGV−−−−−−−−−−−−LA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YSY−−−−−−−−−−−−−−−−−−−−−−GKELDALLDSGVLT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MER−−−−−DGLAAKNLEK−−−−−−−−−−−−−L−−−−−AKG−−−−−−−−−−R−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−−D−−−LVP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EK−−−−−−−−−−−−−−−−−−−−−−−−−HIGYYLINQQI−−−−−−−−−−PHLQDLITHHPT−−−PFLTNS−−−−−−−−−NYLLFPK−−QSARSQ−−−−−−−−ELLG−−−−V−−−−−−−−−−−−−−−−−−−−−−−−−F−−−−−−−N−−−HYLVQ                                                                                        
fig|593589.3.peg.2550   Vibrio cholerae RC9                                                           IASGEWPPFI−−−−−G−−−−−−−SDLP−−−−−−−−−−−−−−−−−N−−YGFV−−GE−−−−−−−II−−−−−−−−−−−TQ−−−AFTK−−−−−QGYQ−−−VE−−−−−−−FQFL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PW−−−−−−−−−−−−AR−−−−−−AYAE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−Q−−−−R−−−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−LYDAT−−−−−−−−A−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IWMHSAER−−−E−−−−−−−−ID−−−−−−FFYS−−−−−−−−−−L−−−−−−−−−PVSQEEFV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FFYPV−−−−K−−−−−−−−KPFD−−−−−W−−−−−−−KTLSDLA−−−−−−−PYKLGGV−−−−−−−−−−−−LA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YSY−−−−−−−−−−−−−−−−−−−−−−GKELDALLDSGVLT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MER−−−−−DGLAAKNLEK−−−−−−−−−−−−−L−−−−−AKG−−−−−−−−−−R−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−−D−−−LVP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EK−−−−−−−−−−−−−−−−−−−−−−−−−HIGYYLINQQI−−−−−−−−−−PHLQDLITHHPT−−−PFLTNS−−−−−−−−−NYLLFPK−−QSARSQ−−−−−−−−ELLG−−−−V−−−−−−−−−−−−−−−−−−−−−−−−−F−−−−−−−N−−−HYLVQ                                                                                        
fig|675808.3.peg.3069   Vibrio cholerae INDRE 91/1                                                           IASGEWPPFI−−−−−G−−−−−−−SDLP−−−−−−−−−−−−−−−−−N−−YGFV−−GE−−−−−−−II−−−−−−−−−−−TQ−−−AFTK−−−−−QGYQ−−−VE−−−−−−−FQFL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PW−−−−−−−−−−−−AR−−−−−−AYAE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−Q−−−−R−−−−−−−−−−−−−−−−−−−−−−G−−−−−−−−−−LYDAT−−−−−−−−A−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IWMHSAER−−−E−−−−−−−−ID−−−−−−FFYS−−−−−−−−−−L−−−−−−−−−PVSQEEFV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FFYPV−−−−K−−−−−−−−KPFD−−−−−W−−−−−−−KTLSDLA−−−−−−−PYKLGGV−−−−−−−−−−−−LA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−YSY−−−−−−−−−−−−−−−−−−−−−−GKELDALLDSGVLT−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MER−−−−−DGLAAKNLEK−−−−−−−−−−−−−L−−−−−AKG−−−−−−−−−−R−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−V−−−D−−−LVP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−E−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EK−−−−−−−−−−−−−−−−−−−−−−−−−HIGYYLINQQI−−−−−−−−−−PHLQDLITHHPT−−−PFLTNS−−−−−−−−−NYLLFPK−−QSARSQ−−−−−−−−ELLG−−−−V−−−−−−−−−−−−−−−−−−−−−−−−−F−−−−−−−N−−−HYLVQ                                                                                        
fig|243277.1.peg.1579   Vibrio cholerae O1 biovar eltor str. N16961                                                           IASGEWPPFI−−−−−G−−−−−−−SDLP−−−−−−−−−−−−−−−−−N−−YGFV−−GE−−−−−−−II−−−−−−−−−−−TQ−−−AFTK−−−−−QGYQ−−−VE−−−−−−−FQFL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PW−−−−−−−−−−−−AR−−−−−−AYAE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−T−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−&#