(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00018668

fig|221360.3.peg.2899   Synechococcus sp. RS9917              ELTTAIGLL−−−−−−−AQR−−LETDDVDIRAQALAELEAA−−LLAEEGNKQALAAKADATCWVIEHLRGQAAYRQQQAKRLT−−−−DLARSDAGRADALEESLVFVLTQLQPAATRFSFPNHEL−−TSRKSQSVEIDDDEVLDSE−−−−−WLT−−−−V−−I−−−−−−−−−−−−−−−−−−−TTTKPDKAAIKE−−−−−ALKAGTE−−−−−−−−−−−−−−−−−−−ITGARLL−−SRRSWRI 
fig|221360.4.peg.2690   Synechococcus sp. RS9917              ELTTAIGLL−−−−−−−AQR−−LETDDVDIRAQALAELEAA−−LLAEEGNKQALAAKADATCWVIEHLRGQAAYRQQQAKRLT−−−−DLARSDAGRADALEESLVFVLTQLQPAATRFSFPNHEL−−TSRKSQSVEIDDDEVLDSE−−−−−WLT−−−−V−−I−−−−−−−−−−−−−−−−−−−TTTKPDKAAIKE−−−−−ALKAGTE−−−−−−−−−−−−−−−−−−−ITGARLL−−SRRSWRI 
fig|221360.4.peg.823   Synechococcus sp. RS9917                                                                            VIEHLRGQAAYRQQQAKRLA−−−−ALATGDASRADALEESLLFVLTQLQPAATRFSFPNHEL−−SSRKSQAVVIDDEEALDPE−−−−−WLA−−−−V−−T−−−−−−−−−−−−−−−−−−−TSSKPDKNAIKE−−−−−ALKAGRQ−−−−−−−−−−−−−−−−−−−ITGAQLL−−FRRSWRI 
fig|221360.3.peg.900   Synechococcus sp. RS9917                                                                            VIEHLRGQAAYRQQQAKRLA−−−−ALATGDASRADALEESLLFVLTQLQPAATRFSFPNHEL−−SSRKSQAVVIDDEEALDPE−−−−−WLA−−−−V−−T−−−−−−−−−−−−−−−−−−−TSSKPDKNAIKE−−−−−ALKAGRQ−−−−−−−−−−−−−−−−−−−ITGAQLL−−FRRSWRI 
fig|221360.4.peg.2628   Synechococcus sp. RS9917                    AQL−−−−−−−AER−−LDTGDDEERALAIADLEES−−LASEEHQREAFVRKADATCWVIERLRAEASYHQSQAKRFA−−−−ALAKGEDNRADALESTLVHLLDRLEPGASSHRLHDHTL−−RSRTTEAIEIDDPEALPAE−−−−−LLT−−−−T−−Q−−−−−−−−−−−−−−−−−−−TTSTPNKSSIK                                                  
fig|221360.3.peg.2836   Synechococcus sp. RS9917                    AQL−−−−−−−AER−−LDTGDDEERALAIADLEES−−LASEEHQREAFVRKADATCWVIERLRAEASYHQSQAKRFA−−−−ALAKGEDNRADALESTLVHLLDRLEPGASSHRLHDHTL−−RSRTTEAIEIDDPEALPAE−−−−−LLT−−−−T−−Q−−−−−−−−−−−−−−−−−−−TTSTPNKSSIK                                                  
fig|518766.7.peg.1342   Rhodothermus marinus DSM 4252            LLEITDELLHLLDQ−−−−−LE−−AAETLDEETARLVDAYLLD−−V−−−−−−EQALEDKIDRYVALMRELELRAKARREEAERLL−−−−ARARRDEERLAFLRERLIAALRRL−−ERMKLETRRYRV−−SVYQSGQPPVELRVPVEALPDE−−−−−LVR−−−−−−−−−−−−−−−−−−−−−−−−−−−IERKPNLRAIRQ−−−−−ALEEG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−R
fig|1148.1.peg.3484   Synechocystis sp. PCC 6803            LWELSDEITNLEDQIADIQDREDLSESEKDQLMGEILETWLS−−T−−−−−−GKEFDAKACNVAAYIKHLEAITEARKNEYRRLR−−−−DLAEQSENQSQRLRNYLVSNMQKL−−GKKKVNGVSVNL−−SLRKKPAKVVLNCPLEDLPAA−−−−−FMK−−−−−−−−−−−−−−−−−−−−−−−−−−−VEITPRLSELKK−−−−−HLQSNAD−−−−−−−−−−−−−−−−−−−CSFAQLADVEEYSVMIK
fig|1148.1.peg.3543   Synechocystis sp. PCC 6803            LWELSDEITNLEDQIADIQDREDLSESEKDQLMGEILETWLS−−T−−−−−−GKEFDAKACNVAAYIKHLEAITEARKNEYRRLR−−−−DLAEQSENQSQRLRNYLVSNMQKL−−GKKKVNGVSVNL−−SLRKKPAKVVLNCPLEDLPAA−−−−−FMK−−−−−−−−−−−−−−−−−−−−−−−−−−−VEITPRLSELKK−−−−−HLQSNAD−−−−−−−−−−−−−−−−−−−CSFAQLADVEEYSVMIK
fig|391612.3.peg.4802   Cyanothece sp CCY 0110            LWNISQEIIELENLINQLQESEELNEEEKEVKINQLFSNWLN−−A−−−−−−DTQFDEKAEKVAHYIKYLEAITEARKAEAKRIR−−−−VLASMSEKQGDKLRKYLIKEMQRV−−NKTKIEGVTCKL−−SMRKKQPSICLKVEPEELPDE−−−−−FKR−−−−−−−−−−−−−−−−−−−−−−−−−−−VKIEPNLTEIRK−−−−−ALKSEKD−−−−−−−−−−−−−−−−−−−IDWAFFDDDEDYSLTIK
fig|43989.4.peg.4449   Cyanothece sp. ATCC 51142            LWNISEEMIELENLINQLQDSEELSEEEKEVKINELFSEWLT−−A−−−−−−DTNFEEKAEKVAHYIKYLEAITEARKAEAKRIR−−−−VLASMSEKQGDKLRNYLIREMQRV−−NKTKIEGVTCKL−−SMRKKQPSICLKVEPEELPDE−−−−−FKR−−−−−−−−−−−−−−−−−−−−−−−−−−−VKIEPNLTEIRK−−−−−ALKSQKD−−−−−−−−−−−−−−−−−−−LDWAFLSDDEDYSLTIK
fig|216592.1.peg.3233   Escherichia coli 042           KLYEIANEYAKL−−−−−−−−MD−−SD−−−−−LEPEMIADTIEG−−M−−−−−−EGEFTDKIEQLLAIIKNESGYAERLKEEAKSLN−−−−ERAAVIQNKIDSIKSYIASSLEMV−−GKKKIRAGIHQV−−TIRKPSETVEIIDSSALPQE−−−−−YVE−−−−F−−E−−−−−−−−−−−−−−−−−−−TTIKADKLAIKH−−−−−QLKAGIN−−−−−−−−−−−−−−−−−−−IPGAQLKVGKPSLLIK
fig|216592.3.peg.832   Escherichia coli 042           KLYEIANEYAKL−−−−−−−−MD−−SD−−−−−LEPEMIADTIEG−−M−−−−−−EGEFTDKIEQLLAIIKNESGYAERLKEEAKSLN−−−−ERAAVIQNKIDSIKSYIASSLEMV−−GKKKIRAGIHQV−−TIRKPSETVEIIDSSALPQE−−−−−YVE−−−−F−−E−−−−−−−−−−−−−−−−−−−TTIKADKLAIKH−−−−−QLKAGIN−−−−−−−−−−−−−−−−−−−IPGAQLKVGKPSLLIK
fig|457401.3.peg.1505   Escherichia sp. 4_1_40B           KLYEIANEYAKL−−−−−−−−MD−−SD−−−−−LEPEMIADTIEG−−M−−−−−−EGEFTDKIEQLLSVIKNESGYAERLKEEAKSLN−−−−ERAAVIQNKIDSIKSYIASSLEMV−−GKKNIRAGIHQV−−TIRKPSETVEIIDSSALPPE−−−−−YLE−−−−F−−E−−−−−−−−−−−−−−−−−−−TTIKADKLAIKH−−−−−QLKAGIN−−−−−−−−−−−−−−−−−−−IPGAQLKVGKPSLLIK
fig|1126911.3.peg.4280   Escherichia coli C639_08           KLYEIANEYAKL−−−−−−−−MD−−SD−−−−−LEPEMIADTIEG−−M−−−−−−EGEFTDKIEQLLSVIKNESGYAERLKEEAKSLN−−−−ERAAVIQNKIDSIKSYIASSLEMV−−GKKNIRAGIHQV−−TIRKPSETVEIIDSSALPPE−−−−−YVE−−−−F−−E−−−−−−−−−−−−−−−−−−−TTIKADKLAIKH−−−−−QLKAGIN−−−−−−−−−−−−−−−−−−−IPGAQLKVGKPSLLIK
fig|869692.4.peg.4030   Escherichia coli 3003           KLYEIANEYAKL−−−−−−−−MD−−SD−−−−−LEPEMIADTIEG−−M−−−−−−EGEFTDKIEQLLSVIKNESGYAERLKEEAKSLN−−−−ERAAVIQNKIDSIKSYIASSLEMV−−GKKNIRAGIHQV−−TIRKPSETVEIIDSSALPPE−−−−−YVE−−−−F−−E−−−−−−−−−−−−−−−−−−−TTIKADKLAIKH−−−−−QLKAGIN−−−−−−−−−−−−−−−−−−−IPGAQLKVGKPSLLIK
fig|331112.6.peg.270   Escherichia coli HS           I−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−HGYAERLKEEAKSLN−−−−ERAAVIQNKIDSIMTYIASSLEMV−−GKKKIRAGIHQV−−TIRKPSETVEIIDSSALPPE−−−−−YVE−−−−F−−E−−−−−−−−−−−−−−−−−−−TTIKADKLAIKH−−−−−QLKAGIN−−−−−−−−−−−−−−−−−−−IPGAQLKVGKPSLLIK
fig|331112.3.peg.266   Escherichia coli HS           I−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−HGYAERLKEEAKSLN−−−−ERAAVIQNKIDSIMTYIASSLEMV−−GKKKIRAGIHQV−−TIRKPSETVEIIDSSALPPE−−−−−YVE−−−−F−−E−−−−−−−−−−−−−−−−−−−TTIKADKLAIKH−−−−−QLKAGIN−−−−−−−−−−−−−−−−−−−IPGAQLKVGKPSLLIK
fig|465516.5.peg.1354   Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066           KLYEIANEYAKL−−−−−−−−MD−−SD−−−−−LEPEMIADTIEG−−M−−−−−−EGEFTDKIEQLLAIIKNESGYAERLKEEAKSLN−−−−ERAAVIQNKIDSIMAYIASSLEMV−−GKKKIRAGIHQV−−TIRKPTETVEIIDSSALPPE−−−−−YVE−−−−F−−E−−−−−−−−−−−−−−−−−−−TTIKADKLAIKH−−−−−QLKAGIN−−−−−−−−−−−−−−−−−−−IPGAYLKVGKTSLLIK
fig|591020.3.peg.332   Shigella flexneri 2002017           KLYEIANEYAKL−−−−−−−−MD−−SD−−−−−LEPEMIADTIEG−−M−−−−−−EGEFTDKIEQLLAIIKNEYGYAERLKDEAKSLN−−−−ERAAVIQNKIDSIMAYIASSLEMV−−GKKKIRAGIHQV−−TIRKPSETVEIIDSSALPPE−−−−−YVE−−−−F−−E−−−−−−−−−−−−−−−−−−−TTIKADKLAIKH−−−−−QLKAGIN−−−−−−−−−−−−−−−−−−−IPGAQLKVGKPSLLIK
fig|1116127.3.peg.2611   Escherichia coli 2848050           KLYEIANEYAKL−−−−−−−−MD−−SD−−−−−LEPEMIADTIEG−−M−−−−−−EGEFTDKIEQLLAIIKNESGYAERLKDEAKSLN−−−−ERAAVIQNKIDSIMAYIASSLEMV−−GKKKIRAGIHQV−−TIRKPSETVEIIDSSALPPE−−−−−YVE−−−−F−−E−−−−−−−−−−−−−−−−−−−TTIKADKLAIKH−−−−−QLKAGIN−−−−−−−−−−−−−−−−−−−IPGAQLKVGKPSLLIK
fig|373384.10.peg.290   Shigella flexneri 5 str. 8401           KLYEIANEYAKL−−−−−−−−MD−−SD−−−−−LEPEMIADTIEG−−M−−−−−−EGEFTDKIEQLLSVIKNETGYAERLKEEAKSLN−−−−ERAAVIQNKINSIMAYIASSLEMV−−GKKKIRAGIHQV−−TIRKSSETVEIFDSSALPPE−−−−−YVE−−−−F−−E−−−−−−−−−−−−−−−−−−−TTIKPDKLAIKH−−−−−QLKAGIN−−−−−−−−−−−−−−−−−−−IPGAQLKVGKPSLLIK
fig|693216.3.peg.1092   Cronobacter turicensis z3032           KLYEVASDYARL−−−−−−−−MD−−AD−−−−−IDPEAMADTLEG−−I−−−−−−EGELADKIEQLLAICKNESTYAERLRDEAKSLT−−−−ERAVSIEKKVENIRAYIATSLETA−−GKKSIRAGIHQV−−TVREPCRSVEITDSALLPPE−−−−−YVE−−−−Y−−D−−−−−−−−−−−−−−−−−−−TVIKPDKMAIKH−−−−−LLEGGKN−−−−−−−−−−−−−−−−−−−VPGATLKTGKPSLLIR
fig|349966.5.peg.4428   Yersinia frederiksenii ATCC 33641               LATDYRKL−−−−−−−−QE−−MADSGDELTPEMVADTLSG−−I−−−−−−EGMLEDKFDALMALVRNTLGQAEICANEAKRMS−−−−ARKKSFDNQAEIYRKYILECMIQA−−GKDSIKTASNTY−−TARKGTKKLVITDVNLLPDE−−−−−YVDSVSQV−−Q−−−−−−−−−−−−−−−−−−−IITTPKADEIKA−−−−−ALNEGLS−−−−−−−−−−−−−−−−−−−IAGAKFETGERSLAVR
fig|634499.3.peg.1751   Erwinia pyrifoliae Ep1/96              DLASDMSKL−−−−−−−−ES−−LAADGGDLTPEMIADTLEG−−I−−−−−−EAMLEDKFDATMRVIRDFDAKAEACKKEAARVS−−−−ERKKHWERQACALKSYLLQCLQIS−−ERTTFKTTLNTF−−TARKGGVSLKIDNVDLLPDE−−−−−FVE−−−−SHTE−−−−−−−−−−−−−−−−−−−VVTTTKNDELKK−−−−−ALQELATKIEAARAAGEEPAPEWLHSIPGAHLETGSPTLQVR
fig|243265.1.peg.3324   Photorhabdus luminescens subsp. laumondii TTO1              ALAADYEKL−−−−−−−−QQ−−LVETGEFSPEDIADTLES−−I−−−−−−ECTIGDKLDAIMIHVRNIEGQAKILADESKRLT−−−−DRKKSFERQVKNLKKYALDCLLKA−−GMDSLRTTRNTF−−TARKGIMNVIIDDESKLPDE−−−−−LVD−−−−V−−Q−−−−−−−−−−−−−−−−−−−TITAPDKKAIKE−−−−−AIENGIN−−−−−−−−−−−−−−−−−−−VPGAHIEIGQRSLQVR
fig|500637.6.peg.2349   Providencia rustigianii DSM 4541     V−−−−−KAIAIAADYDKL−−−−−−−−QQ−−LVESGEFSAEDVADTLEG−−L−−−−−−EGELGDKLDAIMVHVRNIEGQAETLSKESKRLA−−−−ERKNQFDNQIKNLKQYALTCLLTS−−GKDSLKTLRNTF−−TARKGTVSVVIDDESLLPDE−−−−−LID−−−−V−−Q−−−−−−−−−−−−−−−−−−−TVTAPDKKAIKA−−−−−RIDKGEI−−−−−−−−−−−−−−−−−−−IDGAHLETGARTLQVR
fig|500637.6.peg.6016   Providencia rustigianii DSM 4541     V−−−−−KAIAIAADYDKL−−−−−−−−QQ−−LVESGEFSAEDVADTLEG−−L−−−−−−EGELGDKLDAIMVHVRNIEGQAETLSKESKRLA−−−−ERKNQFDNQIKNLKQYALTCLLTS−−GKDSLKTLRNTF−−TARKGTVSVVIDDESLLPDE−−−−−LID−−−−V−−Q−−−−−−−−−−−−−−−−−−−TVTAPDKKAIKA−−−−−RIDKGEI−−−−−−−−−−−−−−−−−−−IDGAHLETGARTLQVR
fig|1141661.3.peg.702   Providencia alcalifaciens Dmel2              AMAADYSKL−−−−−−−−QQ−−LVETGEFTAEDIADTLVG−−I−−−−−−EGELGDKLDAIMLHARNLEGQAKTLDEESKRLA−−−−DRKKSFENQVKSLKKYALDCLLTS−−GLDKLKTTKNTF−−TARAGVVRVIIDNEDALPNE−−−−−LVD−−−−V−−Q−−−−−−−−−−−−−−−−−−−TITAPDKKAIKE−−−−−AIENGID−−−−−−−−−−−−−−−−−−−VPGAHLETGDRSLMVR
fig|349966.5.peg.4340   Yersinia frederiksenii ATCC 33641              ALAADLFKL−−−−−−−−QQ−−LVESSEELTPEMIADTLEG−−L−−−−−−EGALGDKLDATYVFVRNLEGQAKTCDEEAKRLA−−−−DRKRSFENRAKSIKQYVLSCLLAA−−DMNTLKTPYNTF−−TARKGVANVVIDNEDLLPSE−−−−−LVT−−−−V−−Q−−−−−−−−−−−−−−−−−−−TIVAPDKKAIKE−−−−−AIENGVD−−−−−−−−−−−−−−−−−−−VKGAHIEIGSRSLQVR
fig|667127.3.peg.537   Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884              AIAADYQSL−−−−−−−−LQ−−LLESSDELTPEMIADTLEG−−M−−−−−−EGELADKLDSIMVIARNNLGNASTCDDEIKRLA−−−−ERKKSFENKDKALRKYILSCLLAA−−GMDKLKTAKNTF−−TARKGSVSVVIDNTDLLPDE−−−−−LVT−−−−T−−Q−−−−−−−−−−−−−−−−−−−VVIAPDKKAIKE−−−−−AIESAQAAAAQITADGGEIPEELLNPVPGAHLEIGERSLQVR
fig|423368.6.peg.1255   Salmonella enterica subsp. enterica serovar Newport str. SL254              ALAADYTSL−−−−−−−−LQ−−LLESSDELTPEMIADTLES−−I−−−−−−EGELADKLDAIMVIARNNLGHAKTCDEEIKRLA−−−−ERKKHFENKDKTLRKYILSCLMAA−−NLDKLKTSKNTF−−SARKGSISVVIDNEKLLPDE−−−−−LVT−−−−V−−Q−−−−−−−−−−−−−−−−−−−TIIAPDKKAIKE−−−−−AIEAAEAAAAQITADGGEVPAELLNPVPGAHLVIGERSLQVR
fig|858305.3.peg.1487   Salmonella enterica subsp. enterica serovar Newport str. CVM 22462              ALAADYTSL−−−−−−−−LQ−−LLESSDELTPEMIADTLES−−I−−−−−−EGELADKLDAIMVIARNNLGHAKTCDEEIKRLA−−−−ERKKHFENKDKTLRKYILSCLMAA−−NLDKLKTSKNTF−−SARKGSISVVIDNEKLLPDE−−−−−LVT−−−−V−−Q−−−−−−−−−−−−−−−−−−−TIIAPDKKAIKE−−−−−AIEAAEAAAAQITADGGEVPAELLNPVPGAHLVIGERSLQVR
fig|409438.11.peg.2408   Escherichia coli SE11              AIAKEYASL−−−−−−−−ID−−LLETSDELTPEMIADTLEG−−M−−−−−−EGELGDKLDAMMVICRNLQGNANTCAQEMSRLA−−−−TRKTSFEGKEKAIRKHMLTCLQAA−−GLDKLKTAKNTF−−TDAQGAIRVIIDSEDKIPDEYEGVSLVD−−−−V−−E−−−−−−−−−−−−−−−−−−−TVITPNKRAIKE−−−−−VIESAEAVAAEILARGETPPAELLNPVPGAHLERGERSLRVR
fig|331111.3.peg.2   Escherichia coli E24377A              AIAKEYASL−−−−−−−−ID−−LLETSDELTPEMIADTLEG−−M−−−−−−EGELGDKLDAMMVICRNLQGNANTCAQEMSRLA−−−−TRKTSFEGKEKAIRKHMLTCLQAA−−GLDKLKTAKNTF−−TDAQGAIRVIIDSEDKIPDEYEGVSLVD−−−−V−−E−−−−−−−−−−−−−−−−−−−TVITPNKRAIKE−−−−−VIESAGAVAAEILARGETPPAELLNPVPGAHLERGERSLRVR
fig|633699.4.peg.738   Lactobacillus johnsonii FI9785     M−−−−−NVFEINNAIAEI−−−−−−−−EN−−KD−−−−−LDPEVLVDTIQS−−L−−−−−−ELTRDQKLDGAAGLSDKYDSEIQWANDRIKELR−−−−EFIKVSKNKKDRLNQYITNAIDDA−−GLKEIKTEHHIL−−KPRNYRDSVIVEEIRKLPID−−−−−YVV−−−−E−−E−−−−−−−−−−−−−−−−−−−KTIKADKKKLYE−−−−−DLKAGKE−−−−−−−−−−−−−−−−−−−ITGAHLK−−ANRKTLIK
fig|525326.3.peg.311   Lactobacillus gasseri JV-V03     M−−−−−NVFDINNAIEEL−−−−−−−−EQ−−KD−−−−−LDPEVLVDTIES−−L−−−−−−KLTRDQKLDGAAGLSDKYDSQIKWAKERMTELR−−−−EFIKVLTNKKNRLNQFITDAIDDA−−GLKELQTEHHIL−−KPRNYRDSVIVEEVKKLPID−−−−−YVV−−−−E−−E−−−−−−−−−−−−−−−−−−−KTIKADKKKLYE−−−−−DLKAGKE−−−−−−−−−−−−−−−−−−−ITGAHLK−−ANRKTLIK
fig|525330.3.peg.174   Lactobacillus johnsonii ATCC 33200     M−−−−−SAFQINAKIEEL−−−−−−−−QD−−KD−−−−−LDPQVLVDTIES−−L−−−−−−ELTRNEKLDGAAGLIDRSDMKITLAKRKAKEWQ−−−−EVARVEENKKKRLNQYITDVIDGA−−GIKELVTDEHIF−−KPRNFKASVVIDKKEDLPKD−−−−−YIK−−−−Y−−V−−−−−−−−−−−−−−−−−−−EEVKIDKNKLYK−−−−−DLKAGTE−−−−−−−−−−−−−−−−−−−INGAHLK−−AHRGTTIK
fig|575607.3.peg.711   Lactobacillus jensenii SJ-7A-US     M−−−−−NLFEINSAIEII−−−−−−−−KQ−−KD−−−−−LDPEVLADTLES−−L−−−−−−ELARDEKLDSIASWIEDNKSRIDWLAEKNKTLA−−−−EEKARLTKQNDRLMEFLTNQIDEA−−GYKQLQTKNHLL−−KPRNYRAKTVIDNEALLPDV−−−−−YKK−−−−K−−E−−−−−−−−−−−−−−−−−−−EVIKIDKKQLYS−−−−−DLKDGRE−−−−−−−−−−−−−−−−−−−VAGARWE−−PNRKTTI 
fig|1036177.3.peg.1112   Lactobacillus plantarum subsp. plantarum NC8     M−−−−−NLYEMATNYRDL−−−−−−−−TN−−RDD−−−−LNPDTIADTLDA−−L−−−−−−TDSMNVKVDNIASWIDENAADIDFLDKRMKSLR−−−−EEKQRLKSLNDRLNHYLADTLDQA−−EIKKLTTDQHLV−−SVRNYRASTVVSEPDKLTAD−−−−−YVK−−−−E−−V−−−−−−−−−−−−−−−−−−−HEYQPDKTAIYK−−−−−ALSAGKN−−−−−−−−−−−−−−−−−−−VPGAHLE−−PNRKAVIK
fig|1328309.5.peg.1253   Lactobacillus plantarum IPLA88     M−−−−−NLYEMATNYRDL−−−−−−−−TN−−RDD−−−−LNPDTIADTLDA−−L−−−−−−TDSMNVKVDNIASWIDENAADIDFLDKRMKSLR−−−−EEKQRLKSLNDRLNHYLADTLDQA−−EIKKLTTDQHLV−−SVRNYRASTVVSEPDKLTAD−−−−−YVK−−−−E−−V−−−−−−−−−−−−−−−−−−−HEYQPDKTAIYK−−−−−ALSAGKN−−−−−−−−−−−−−−−−−−−VPGAHLE−−PNRKAVIK
fig|349123.6.peg.498   Lactobacillus reuteri 100-23     M−−−−−NLFELNDNYKTL−−−−−−−−AS−−RDD−−−−LDPTILKDTLES−−I−−−−−−KDDRKTKLDNLASWADHLKSEIDFMTDKKKSWE−−−−EEITYRKNKLTWIKKYITEVLDDA−−GIKKITTENHLL−−SARNFKASTIIDSDKKLPDK−−−−−FKI−−−−T−−E−−−−−−−−−−−−−−−−−−−TTTKPDKQAIYQ−−−−−ALKAGEE−−−−−−−−−−−−−−−−−−−VPGAHLK−−ANRNTVIK
fig|334390.3.peg.506   Lactobacillus fermentum IFO 3956           KLYELSDKYKEL−−−−−−−−SE−−RED−−−−LDPEVLHDTLDA−−I−−−−−−NDAIEDKADNIAAWIDDLTSAAKRKKAKAKEWN−−−−DSAKADLNKADSLKKYLIQELTYA−−GKKKMETDRFLL−−STRNNAPSTVIDDETLIPDT−−−−−FKN−−−−T−−K−−−−−−−−−−−−−−−−−−−VTESVDKTAIKE−−−−−AIKLGED−−−−−−−−−−−−−−−−−−−VPGAHLQ−−ASKSITIK
fig|575599.3.peg.1698   Lactobacillus fermentum 28-3-CHN     M−−−−−KLYELSDAYKEL−−−−−−−−LE−−RED−−−−LDPQAVVDTLDA−−I−−−−−−KDEIEIKADGIASVIDELQSSAERKKAKAKDWN−−−−ESAKADLQRAQWLKQYLTSELDNA−−GIKKVETDNHLL−−RVRNFKASTVIDDFDSLPDD−−−−−YKL−−−−T−−K−−−−−−−−−−−−−−−−−−−TEIVGDKVGIYQ−−−−−ALKAGKT−−−−−−−−−−−−−−−−−−−VPGAHLK−−DNRSVVIK
fig|585161.3.peg.1832   Staphylococcus aureus subsp. aureus WW2703/97           NLYELSEAFKEM−−−−−−−−SN−−QDE−−−−LDPTLLKDTLDS−−I−−−−−−KAEMNVKVDNIVNWRRETLGDIDVIDKEIKRLQ−−−−NLKKQKQNLTDRLKDYLKEMLETQ−−EIDSYRTATNHI−−YKRKNGASKNIIDEKLIPKD−−−−−YWL−−−−−−−S−−−−−−−−−−−−−−−−−−−QAPKLNSKQLID−−−−−DLKAGKD−−−−−−−−−−−−−−−−−−−IPGAELK−−VTESLVIK
fig|426430.6.peg.970   Staphylococcus aureus subsp. aureus str. Newman           NLYELSEAFKEM−−−−−−−−SN−−QDE−−−−LDPTLLKDTLDS−−I−−−−−−KAEMNVKVDNIVNWRRETLGDIDVIDKEIKRLQ−−−−NLKKQKQNLTDRLRDYLKEMLETQ−−EVDSYRTATNHI−−YKRKNGASKNIIDEKLIPKD−−−−−YWL−−−−−−−S−−−−−−−−−−−−−−−−−−−QAPKLNSKQLID−−−−−DLKAGKD−−−−−−−−−−−−−−−−−−−IPGAELK−−VTESLVIK
fig|585156.3.peg.1023   Staphylococcus aureus subsp. aureus M1015           NLYELSEAFKEM−−−−−−−−SN−−QDE−−−−LDQTLLKDTLDS−−I−−−−−−QAEMNVKVDNIVNWRRETLGDIDVIDKEIKRLQ−−−−NLKKQKQNLTDRLRDYLKEMLETQ−−EVDSYRTATNHI−−YKRKNGASKNIIDEKLIPKD−−−−−YWL−−−−−−−S−−−−−−−−−−−−−−−−−−−QAPKLNSKQLID−−−−−DLKAGKD−−−−−−−−−−−−−−−−−−−IPGAELK−−VTESLVIK
fig|1158692.3.peg.788   Staphylococcus aureus M0687           NLYELSEAFKEL−−−−−−−−SN−−QDE−−−−LDQTLLKDTLDS−−I−−−−−−QAEMNVKVDNIVNWRRETLGDIDVIDKEIKRLQ−−−−NLKKQKQNLTDRLRDHLKEMLETQ−−EVDSYRTATNHI−−YKRKNGASKNIIDEKLIPKD−−−−−YWL−−−−−−−S−−−−−−−−−−−−−−−−−−−QAPKLNSKQLID−−−−−DLKAGKD−−−−−−−−−−−−−−−−−−−IPGAELK−−VTESLVIK
fig|1158536.3.peg.2211   Staphylococcus aureus M0571           NLYELSEAFKEL−−−−−−−−SN−−QDE−−−−LDQTLLKDTLDS−−I−−−−−−QAEMNVKVDNIVNWRRETLGDIDVIDKEIKRLQ−−−−NLKKQKQNLTDRLRDYLKEMLETQ−−EVDSYRTATNHI−−FKRKNGASKNIIDEKLIPKD−−−−−YWL−−−−−−−S−−−−−−−−−−−−−−−−−−−QAPKLNSKQLID−−−−−DLKAGKD−−−−−−−−−−−−−−−−−−−IPGVELK−−VTESLVIK
fig|948563.3.peg.2165   Staphylococcus aureus O46           NLYELSEAFKEL−−−−−−−−SN−−QDE−−−−LDQTLLKDTLDS−−I−−−−−−QAEMNVKVDNIVNWRRETLGDIDVIDKEIKRLQ−−−−NLKKQKQNLTDRLRDYLKEMLETQ−−EVDSYRTATNHI−−YKRKNGASKNIIDEKLIPKD−−−−−YWL−−−−−−−S−−−−−−−−−−−−−−−−−−−QAPKLNSKQLID−−−−−DLKDGKD−−−−−−−−−−−−−−−−−−−IPGVELK−−VTESLVIK
fig|585155.3.peg.2601   Staphylococcus aureus subsp. aureus H19           NLYELSEAFKEL−−−−−−−−SN−−QDE−−−−LDPTLLKDTLDS−−I−−−−−−KAEMNVKVDNIVNWRRETLGDIDVIDKEIKRLQ−−−−NLKKQKQNLTDRLRDYLKEMLETQ−−EVDSYRTATNHI−−YKRKNGASKNIIDEKLIPKD−−−−−YWL−−−−−−−S−−−−−−−−−−−−−−−−−−−QAPKLNSKQLID−−−−−DLKDGKD−−−−−−−−−−−−−−−−−−−IPGVELK−−VTESLVIK
fig|266835.9.peg.6381   Mesorhizobium loti MAFF303099            LAQLQDA−−−−−−−−−−−−−−−−−−−−GHGGDTDLAADIIEG−−−−−−−−−ETSLHETVAAAIDQIDNLDVMVIGLKAKEEAFA−−−−DRRKSIEARAENLRAAIEQAMIAA−−EQVSIPLPSATV−−FISKRKPALFVENEADIPSE−−−−−FFV−−−−EQER−−−−−−−−−−−−−−−−−−−PAPKLDKRALAA−−−−−ALAGGRK−−−−−−−−−−−−−−−−−−−VPGAALDNGTVSLSIR
fig|266835.1.peg.6273   Mesorhizobium loti MAFF303099            LAQLQDA−−−−−−−−−−−−−−−−−−−−GHGGDTDLAADIIEG−−−−−−−−−ETSLHETVAAAIDQIDNLDVMVIGLKAKEEAFA−−−−DRRKSIEARAENLRAAIEQAMIAA−−EQVSIPLPSATV−−FISKRKPALFVENEADIPSE−−−−−FFV−−−−EQER−−−−−−−−−−−−−−−−−−−PAPKLDKRALAA−−−−−ALAGGRK−−−−−−−−−−−−−−−−−−−VPGAALDNGTVSLSIR
fig|395492.8.peg.4331   Rhizobium leguminosarum bv. trifolii WSM2304            MSNLRSQ−−−−−−−−−−−−−−−−−−−−GVDDDQELVADTIEG−−−−−−−−−GTTLLEAIQAALAEIDECEIHIIGLKAKEAEFA−−−−ERRRRLEERAGRVKATIEQAMITT−−EQESFRLPTATL−−TLTKRAPGLIVTNEADIPTR−−−−−FWI−−−−EQER−−−−−−−−−−−−−−−−−−−PAPKLDKKALRA−−−−−ALD−−DQP−−−−−−−−−−−−−−−−−−−IPGATLDNGSRSLSIR
fig|366394.8.peg.5075   Sinorhizobium medicae WSM419                                                                      IEAALAQIDECDVLITGLKAKEEEFE−−−−TRRKSIERRAERVRALIEQAMLAT−−DQTSLKLPTATL−−SLTKRAPGLIVNSEADIPSR−−−−−FFV−−−−EQER−−−−−−−−−−−−−−−−−−−PAPKLDKKALAA−−−−−AIKAGEQ−−−−−−−−−−−−−−−−−−−VPGANLDNGSISLSVR
fig|1234597.4.peg.3010   Ochrobactrum intermedium M86          YDVTVLEREFADL−−−−−−−−VA−−AYPELAEDDELRADTIEG−−−−−−−−−ETDAYRVLGKIVAIERDANSMVLAIGERAKELA−−−−ARKDRYTRRKDAMRALLLRLLKAA−−DLNKVSLPEATV−−SVGKGRAGVEIVDESAVPAR−−−−−FLK−−−−−−−−−−−−−−−−−−−−−−−−−−−VVKSPDKTLIKE−−−−−ALDAGKT−−−−−−−−−−−−−−−−−−−VKGAVLREGQPTLTVR
fig|641118.3.peg.3623   Ochrobactrum intermedium LMG 3301          YDVTVLEREFADL−−−−−−−−VA−−AYPELAEDDELRADTIEG−−−−−−−−−ETDAYRVLGKIVAIERDANSMVLAIGERAKELA−−−−ARKDRYTRRKDAMRALLLRLLKAA−−DLNKVSLPEATV−−SVGKGRAGVEIVDESAVPAR−−−−−FLK−−−−−−−−−−−−−−−−−−−−−−−−−−−VVKSPDKTLIKE−−−−−ALDAGKT−−−−−−−−−−−−−−−−−−−VKGAVLREGQPTLTVR
fig|391612.3.peg.5241   Cyanothece sp CCY 0110                     QI−−−−−−−−LQ−−ILESNDDEDGLFLELQQY−−L−−−−−−TEATQAKVDGYCWIEKDLKAEIDEWETKKKRLARMCDEVIERKQKQLDGLKQNLLRLAELGLIDDYLIGYNKAI−−EIRPNPKPTVEVFKEADVPEI−−−−−YRQ−−−−−−PK−−−−−−−−−−−−−−−−−−−IQWTIDKQAIAQ−−−−−AHQAGKD−−−−−−−−−−−−−−−−−−−V                
fig|485915.5.peg.1714   Desulfohalobium retbaense DSM 5692           NLAAIEHEISTI−−−−−−−−LT−−VADELDGEQQEVALDYLRD−−L−−−−−−GIQEEAKVDGISFAVRKRKNEIEWLKTEEKRIK−−−−ARRQAIENRLEGFREYLRWLMEEN−−GLQRLKGRLGSI−−SLRNV−−DSVQVRSLGEVPRE−−−−−FVE−−−−E−−V−−−−−−−−−−−−−−−−−−−VTYKARKREILN−−−−−ALKAGEA−−−−−−−−−−−−−−−−−−−IPGASLH−−TRKVAYIR
fig|555779.3.peg.3217   Desulfonatronospira thiodismutans ASO3-1            LADIEMEIANI−−−−−−−−LA−−TAEELPEEQQEVALEYLEE−−L−−−−−−AIAEIEKIDAVGYAVRKRQSEIDFLKSEETRLR−−−−NKRQAMEKRLSDFKAYLAELFQRE−−EIHKIKGVSTTA−−YLRRS−−SSVEVTDISQLPSD−−−−−YVE−−−−T−−R−−−−−−−−−−−−−−−−−−−IDFVPRKSQIRD−−−−−ALKQGQE−−−−−−−−−−−−−−−−−−−IPGARMQ−−EKQSLVL 
fig|555779.3.peg.1883   Desulfonatronospira thiodismutans ASO3-1                  EIANI−−−−−−−−LA−−TAEELSEDQQEVALEYLDE−−L−−−−−−AIAEYEKIDAVGYAVRKRQSEIQFLKDEEVRLR−−−−NKRQAMEKRLSDFKAYLVELFQRE−−EIHKIKGVSTTA−−YLRRS−−SSVEVTDISQLPSD−−−−−YVE−−−−T−−R−−−−−−−−−−−−−−−−−−−IDFVPRKSQIRD−−−−−ALKQGQE−−−−−−−−−−−−−−−−−−−IPGARMQ−−EKQSLVL 
fig|556268.6.peg.186   Oxalobacter formigenes HOxBLS            LYQLAAELEAL−−−−−−−−RQ−−KLIENGNDDQTVADTLEG−−E−−−−−−ALDFDNKILACAYARKDLGALLAARKEALREMQ−−−−EAIERTERQIGRLDGYMMAAMRRV−−NRPMISGRHFTV−−QIMGKVPAVIIENRELIPDG−−−−−FYRLADSK−−P−−−−−−−−−−−−−−−−−−−PSPVIDKKAISE−−−−−ALKRGES−−−−−−−−−−−−−−−−−−−IPGAKLD−−DGKKLVIR
fig|556269.4.peg.1476   Oxalobacter formigenes OXCC13                                        NGADEQTIADTLDG−−E−−−−−−ALDFDNKILACAYAKKDLEAIAEGRKEAVREMQ−−−−ESLRATERQIERLDEYMITAMLTV−−DRLNIPGKHFNV−−DVKGKAQSVIIDDPASIPPF−−−−−YYRTPEPK−−A−−−−−−−−−−−−−−−−−−−PTPVIDKKAIAD−−−−−AIKQGAV−−−−−−−−−−−−−−−−−−−VPGAKLD−−NGKRLVIK
fig|360910.4.peg.1313   Bordetella avium 197N            LYDIAPQHREL−−−−−−−−AE−−RLRSMGLDDDAVADTLEA−−−−−−−−−ESDLPGKVETYCIVLREKEADIEAFKREKERFE−−−−ERIKASESAIKRMKLTLLAGLKAA−−GETKVKAGLFSV−−VVQKSKGSVLIEHPELIPKS−−−−−YMT−−−−DPKP−−−−−−−−−−−−−−−−−−−PAPQPDKNLIYA−−−−−AIADGHK−−−−−−−−−−−−−−−−−−−VPGAKVV−−PGERLAIR
fig|572477.4.peg.3151   Allochromatium vinosum DSM 180     I−−−−−RLYELSADYLTA−−−−−−−−LD−−ALVDLDDLPSEVIADTLEG−−L−−−−−−AGVWEEKALNVARYIRNLEAEAAAIEEAKKRME−−−−IRAKAAANRAARLKEYLKAELERT−−GLKPKAPDLAL−−SLRSNPPAVILEDENRIPDD−−−−−YRS−−−−T−−E−−−−−−−−−−−−−−−−−−−TVTRILKSEISN−−−−−ALKAGVE−−−−−−−−−−−−−−−−−−−IPGARLE−−QSRRLVIQ
fig|472759.3.peg.25   Nitrosococcus halophilus Nc4     L−−−−−RLYKIANDYLEA−−−−−−−−LE−−GLAEIDDLPGEVIADTLEG−−L−−−−−−QGAFEIKARHVAAYIRSIEAEASAIKEARKAME−−−−QRERSMVRHAERLRGYLETQMERT−−GITRIGDPELLL−−KIQPSPPKVVIDDEKLVPVE−−−−−YKE−−−−D−−R−−−−−−−−−−−−−−−−−−−VETVVLKSEISK−−−−−ALKAGEQ−−−−−−−−−−−−−−−−−−−VPGAHLE−−QGRRLVI 
fig|323261.3.peg.3016   Nitrosococcus oceani ATCC 19707     L−−−−−RLYAIADDYLEV−−−−−−−−LE−−GLAEIDDLPAEVITDTLEG−−L−−−−−−QGAFEVKARHVAAYIRSLEAEASAIKEARKAME−−−−QRERSMMRHVKRLRGYLETHMERT−−GITRIKSPELSL−−RLQASPPKVVIDNEEQVPAR−−−−−YKE−−−−I−−R−−−−−−−−−−−−−−−−−−−TETVLLKSSLGE−−−−−TLKDGEY−−−−−−−−−−−−−−−−−−−VPGAHLE−−QSKRLVI 
fig|176279.9.peg.1485   Staphylococcus epidermidis RP62A     M−−−−−KLYDYADQYQNL−−−−−−−−IN−−FMEENDYSFEEMKDTLES−−I−−−−−−QESAEGKVINIGKVIQKYQDDIKVINERKKALD−−−−ELKKKAERNIDNLKQYGLVQMSRL−−DMKKVASPTLTV−−SIRNSKVMNIKDESKLPKE−−−−−YIT−−−−E−−K−−−−−−−−−−−−−−−−−−−VEKKVDKAAFKKYYNGLSTEEQEA−−−−−−−−−−−−−−−−−−−IDYAEIE−−VKQNILIK
fig|176279.3.peg.1483   Staphylococcus epidermidis RP62A     M−−−−−KLYDYADQYQNL−−−−−−−−IN−−FMEENDYSFEEMKDTLES−−I−−−−−−QESAEGKVINIGKVIQKYQDDIKVINERKKALD−−−−ELKKKAERNIDNLKQYGLVQMSRL−−DMKKVASPTLTV−−SIRNSKVMNIKDESKLPKE−−−−−YIT−−−−E−−K−−−−−−−−−−−−−−−−−−−VEKKVDKAAFKKYYNGLSTEEQEA−−−−−−−−−−−−−−−−−−−IDYAEIE−−VKQNILIK
fig|198466.1.peg.1251   Streptococcus pyogenes MGAS315            LYELEGIAAYL−−−−−−−−ES−−LD−−−−−LDDETFQNTLDS−−IDF−−−−QSDLENTIEYFVKMLKNAQADVEMYKAEKEAFY−−−−KKQKQAEAKVEKYKETIRRAMELS−−QKKKVDAGMFKV−−SLRKS−−KKVEILDETKIPLD−−−−−YMQ−−−−E−−K−−−−−−−−−−−−−−−−−−−IEYKPMKSEISK−−−−−ALKSGID−−−−−−−−−−−−−−−−−−−ISGVELI−−ETESLQVK
fig|370552.3.peg.1346   Streptococcus pyogenes MGAS10270            LYELEGIAAYL−−−−−−−−ES−−LD−−−−−LDDETFQNTLDS−−IDF−−−−QSDLENTIEYFVKMLKNAQADVEMYKAEKEAFY−−−−KKQKQAEAKVEKYKETIRRAMELS−−QKKKVDAGMFKV−−SLRKS−−KKVEILDETKIPLD−−−−−YMQ−−−−E−−K−−−−−−−−−−−−−−−−−−−IEYKPMKSEISK−−−−−ALKSGID−−−−−−−−−−−−−−−−−−−ISGVELI−−ETESLQVK
fig|471876.6.peg.1549   Streptococcus pyogenes NZ131            LYELEGIAAYL−−−−−−−−ER−−LD−−−−−LDDETFQNTLDS−−IDF−−−−QSDLENTIEYFVKMLKNAQADVEMYKAEKEAFY−−−−KKQKQAEAKVEKYKETIRRAMELS−−QKKKVDAGMFKV−−SLRKS−−KKV                                                                                                            
fig|293653.3.peg.1350   Streptococcus pyogenes MGAS5005            LYELEGIAAYL−−−−−−−−ES−−LD−−−−−LDDETFQNTLDS−−IDF−−−−QSDLENNIEYFVKMLKNAQADVEMYKAEKEAFY−−−−KKQKQAEAKVEKYKETIRRAMELS−−QKKKVDAGMFKV−−SLRKS−−KKVEILDETKIPLD−−−−−YMQ−−−−E−−K−−−−−−−−−−−−−−−−−−−IEYKPMKSEISK−−−−−ALKSGID−−−−−−−−−−−−−−−−−−−ISGVELI−−ETESLQVK
fig|486410.3.peg.1635   Streptococcus dysgalactiae subsp. equisimilis GGS_124            LYELEGIAAYL−−−−−−−−ES−−LD−−−−−LDDETFQNTLDS−−IDF−−−−QSDLENNIEYFVKMLKNVQADAEMYKAEKEAFY−−−−KKQKQAEAKAEKYKETIRRAMELS−−QKKKVDAGMFKV−−SLRRS−−KKIEILDETKIPLD−−−−−YMQ−−−−E−−K−−−−−−−−−−−−−−−−−−−IEYKPMKSEISK−−−−−ALKSGIE−−−−−−−−−−−−−−−−−−−VSGVELI−−ETESLQVK
fig|1154923.3.peg.733   Streptococcus agalactiae GB00601            LYELEGIYAQL−−−−−−−−QS−−MD−−−−−LDEETFQDTLDS−−IDF−−−−QSDLENNIEYFVKMLKNVQADAEKYKAEKEAFY−−−−KKQKQAEAKAEKYKETIRLAMELS−−QKKKVDAGMFKV−−SLRRS−−KKVEILDETKIPLD−−−−−YMQ−−−−E−−K−−−−−−−−−−−−−−−−−−−IEYKPMKAEISK−−−−−ALKSGID−−−−−−−−−−−−−−−−−−−ISGVELI−−ETESLQVK
fig|370552.3.peg.548   Streptococcus pyogenes MGAS10270            LYELEGIYAQL−−−−−−−−QS−−MD−−−−−LDEETFQDTLDS−−IDF−−−−QADLENNIEYFVKMLKNAQANEEMYKAEKEAFY−−−−EKQKQAQAKIDKYKETIHLAMALS−−NKKKVDAGMFKV−−SLRKN−−KKVEVLDETKIPLE−−−−−YMT−−−−E−−K−−−−−−−−−−−−−−−−−−−IERKPDKKELAK−−−−−LLKTGQE−−−−−−−−−−−−−−−−−−−IAGVELI−−ETESLQVK
fig|370552.3.peg.806   Streptococcus pyogenes MGAS10270            LYELEGIYAQL−−−−−−−−QS−−MD−−−−−LDEETFQDTLDS−−IDF−−−−QADLENNIEYFVKMLKNAQANEEMYKAEKEAFY−−−−EKQKQAQAKIDKYKETIHLAMALS−−NKKKVDAGMFKV−−SLRKN−−KKVEVLDETKIPLE−−−−−YMT−−−−E−−K−−−−−−−−−−−−−−−−−−−IERKPDKKELAK−−−−−LLKTGQE−−−−−−−−−−−−−−−−−−−IAGVELI−−ETESLQVK
fig|198466.1.peg.963   Streptococcus pyogenes MGAS315            LYELEGIYAQL−−−−−−−−QS−−MD−−−−−LDEETFQDTLDS−−IDF−−−−QADLENNIEYFVKMLKNAQADEEMYKAEKEAFY−−−−EKQKQAQAKIDKYKETIHLAMALS−−NKKKVDAGMFKV−−SLRKN−−KEVEVLDETKIPLE−−−−−YMT−−−−E−−K−−−−−−−−−−−−−−−−−−−IERKPDKKELAK−−−−−LLKTGQE−−−−−−−−−−−−−−−−−−−IAGVELI−−ETESLQVK
fig|198466.1.peg.1345   Streptococcus pyogenes MGAS315            LYELEGIYAQL−−−−−−−−QS−−MD−−−−−LDEETFQDTLDS−−IDF−−−−QADLENNIEYFVKMLKNAQADEEMYKAEKEAFY−−−−EKQKQAQAKIDKYKETIHLAMALS−−NKKKVDAGMFKV−−SLRKN−−KKVEVLDETKIPLE−−−−−YMT−−−−E−−K−−−−−−−−−−−−−−−−−−−IERKPDKKELAK−−−−−LLKTGQE−−−−−−−−−−−−−−−−−−−IAGVELI−−ETESLQVK
fig|286604.5.peg.1007   Streptococcus suis 89/1591            LYELEGIYVQL−−−−−−−−QA−−ME−−−−−LDDETFNDTLES−−IDF−−−−EEDFAQSCEWFIKMQRNAEADAERFKAEKDAFA−−−−KKQKEAEARAERFKERVKEAMLLT−−NQQKVDTGLFKL−−SLRKT−−ESVTVFDATKLTDD−−−−−FLK−−−−−−−−−−−−−−−−−−−−−−−−−−−VKVEPNKTEIKK−−−−−AIKNGQV−−−−−−−−−−−−−−−−−−−VSGAELT−−EGRSLVVK
fig|1336.3.peg.1794   Streptococcus equi           KLYELVGEYRDL−−−−−−−−YE−−LN−−−−−LDDETLKDTLDS−−IDW−−−−ADRLSEKVEGYAQVIETALAEAKMFEEAEKKFK−−−−AKKEAAKKKAAWLQGNVFDAMKLT−−NQTEIKSGIFTV−−RIKQNPESVKV−−DEELLPKK−−−−−YFN−−−−K−−K−−−−−−−−−−−−−−−−−−−ITVAPDKTTLKE−−−−−LLKSGKK−−−−−−−−−−−−−−−−−−−IKGAELI−−RTEKLVIK
fig|148942.4.peg.721   Streptococcus equi subsp. equi           KLYELVGEYRDL−−−−−−−−YE−−LN−−−−−LDDETLKDTLDS−−IDW−−−−ADRLSEKVEGYAQVIETALAEAKMFEEAEKKFK−−−−AKKEAAKKKAAWLQGNVFDAMKLT−−NQTEIKSGIFTV−−RIKQNPESVKV−−DEELLPKK−−−−−YFN−−−−K−−K−−−−−−−−−−−−−−−−−−−ITVAPDKTTLKE−−−−−LLKSGKK−−−−−−−−−−−−−−−−−−−IKGAELI−−RTEKLVIK
fig|406557.4.peg.2033   Streptococcus pneumoniae SP6-BS73            LYELTGQFLTV−−−−−−−−YQ−−MD−−−−−IDDETKTDTLEA−−IDW−−−−QEQFEQKAEGYAHVIKNLEADVAMYKAEEESFK−−−−AKKQVAQKKLDYVKDNIMAAMNVT−−GQTEVKSGALII−−KIAKNPESVKV−−NEDDLPKK−−−−−YFT−−−−K−−K−−−−−−−−−−−−−−−−−−−VTLAPDKKTLKE−−−−−LLKSGKK−−−−−−−−−−−−−−−−−−−VKGAELV−−RTEKLVIK
fig|406557.5.peg.2150   Streptococcus pneumoniae SP6-BS73            LYELTGQFLTV−−−−−−−−YQ−−MD−−−−−IDDETKTDTLEA−−IDW−−−−QEQFEQKAEGYAHVIKNLEADVAMYKAEEESFK−−−−AKKQVAQKKLDYVKDNIMAAMNVT−−GQTEVKSGALII−−KIAKNPESVKV−−NEDDLPKK−−−−−YFT−−−−K−−K−−−−−−−−−−−−−−−−−−−VTLAPDKKTLKE−−−−−LLKSGKK−−−−−−−−−−−−−−−−−−−VKGAELV−−RTEKLVIK
fig|1131630.3.peg.1610   Streptococcus pneumoniae GA62331            LYELTGQFLTI−−−−−−−−YQ−−MD−−−−−IDDETKTDTLEA−−IDW−−−−QEQFEQKAEGYAHVIKNLEADVAMYKAEEESFK−−−−AKKQVAQKKLDYVKDNIMAAMNVT−−GQTEVKSGALII−−KIAKNPESVKV−−NEDDLPKK−−−−−YFT−−−−K−−K−−−−−−−−−−−−−−−−−−−VTLAPDKKTLKE−−−−−LLKSGKK−−−−−−−−−−−−−−−−−−−VKGAELV−−RTEKLVIK
fig|406563.4.peg.1644   Streptococcus pneumoniae SP23-BS72            LYELTGQFLTI−−−−−−−−YQ−−LD−−−−−IDDETKADTLEA−−IDW−−−−QEQFEQKAEGYAHVIKNLEADVAMYKAEEESFK−−−−AKKQVAQKKLDYVKDNIMAAMNVT−−GQTEVKSGALII−−KIAKNPESVKV−−NEDDLPKK−−−−−YFT−−−−K−−K−−−−−−−−−−−−−−−−−−−VTLAPDKKTLKE−−−−−LLKSGKK−−−−−−−−−−−−−−−−−−−VKGAELV−−RTEKLVIK
fig|406558.6.peg.1202   Streptococcus pneumoniae SP9-BS68            LYELTGQFLTI−−−−−−−−YQ−−LD−−−−−IDDETKADTLEA−−IDW−−−−QEQFEQKAEGYAHVIKNLEADVAMYKAEEESFK−−−−AKKQAAQKKLDYVKDNIMAAMNVT−−GQTEVKSGALII−−KIAKNPESVKV−−NENDLPK                                                                                                 
fig|760827.3.peg.1547   Streptococcus pneumoniae GA44511            LYELTGQFLTI−−−−−−−−YQ−−LD−−−−−IDDETKADTLEA−−IDW−−−−QEQFEQKAEGYAHVIKNLEADVAMYKAEEESFK−−−−AKKQAAQKKLDYVKDNIMAAMNVT−−GQTEVKSGALII−−KIAKNPESVKV−−NENDLPKK−−−−−YFT−−−−K−−K−−−−−−−−−−−−−−−−−−−VTLAPDKKTLKE−−−−−LLKSGKK−−−−−−−−−−−−−−−−−−−VKGAELI−−RTEKLVIK
fig|485918.5.peg.6959   Chitinophaga pinensis DSM 2588            LFNIRQEHLSL−−−−−−−−LT−−EIEDNEGELTEEILAKLQL−−S−−−−−−QEDFQSKVISYGFVIKKLDAESDVIAAEIKRLQ−−−−SLKSKADKRADLFRKIIDEGMKQF−−GYDKVESELLKI−−SYHKSSPVELLENFSDNILQ−−−−−YVKVNFNINPELADKAAEAGITEDVLSVFNVIPSASKERIKD−−−−−QLKAGIK−−−−−−−−−−−−−−−−−−−IPGASIE−−EKKSLQIR
fig|585506.3.peg.1769   Weissella paramesenteroides ATCC 33313     M−−−−−NLYEMQGDFLRL−−−−−−−−YN−−SDI−−−−DDDELKQDTLDA−−I−−−−−−RDASSDKLIGYGHVIRNLEADRDALKAEEKQLS−−−−EKRKTIENKISRMMSAVDEAMYTF−−GMNEVDAGNFKF−−KYRKS−−SKVVIDDEESVPPQ−−−−−YA−−−−−−−−E−−−−−−−−−−−−−−−−−−−YKVSLKRADIKD−−−−−AIKSGIE−−−−−−−−−−−−−−−−−−−VPGARIV−−DNQTLGLR
fig|365659.3.peg.420   Streptococcus mitis B6            LYELTGQYLEI−−−−−−−−YN−−ME−−−−−LDEETKLDTLDS−−IDW−−−−ETEYETKVENYIKVMKNIDADVEARKAEIKRLT−−−−ELNKADEKKKDHLKDTLSASMNMT−−GHERVDTPLFKV−−SFRKS−−QAVEV−−DETVLPEA−−−−−YKV−−−−−−−−−−−−−−−−−−−−−−−−−−−ATWKPDKKRLKE−−−−−DLKNGLE−−−−−−−−−−−−−−−−−−−IIGASLV−−ERKNLSIR
fig|406560.5.peg.2567   Streptococcus pneumoniae SP14-BS69            LYELTGQFLDV−−−−−−−−YN−−LE−−−−−LDEETKLDTLDS−−IDW−−−−EIEYETKVENYIKVMKNLEADVEARKNEIKRLM−−−−ELNKADEKKKEHLKDTLSASMSLT−−GHERVDTPLFKV−−SFRKS−−QAVEV−−DETVLPEY−−−−−YKV−−−−−−−−−−−−−−−−−−−−−−−−−−−ATWKADKKRLKE−−−−−DLKKGLE−−−−−−−−−−−−−−−−−−−IIGASLV−−EHKKL   
fig|406560.4.peg.2368   Streptococcus pneumoniae SP14-BS69            LYELTGQFLDV−−−−−−−−YN−−LE−−−−−LDEETKLDTLDS−−IDW−−−−EIEYETKVENYIKVMKNLEADVEARKNEIKRLM−−−−ELNKADEKKKEHLKDTLSASMSLT−−GHERVDTPLFKV−−SFRKS−−QAVEV−−DETVLPEY−−−−−YKV−−−−−−−−−−−−−−−−−−−−−−−−−−−ATWKADKKRLKE−−−−−DLKKGLE−−−−−−−−−−−−−−−−−−−IIGASLV−−EHKKL   
fig|411470.6.peg.1909   Ruminococcus gnavus ATCC 29149              EIDEEILNC−−−−−−−−VD−−−−−−−QETGEIIDPEKLAQ−−L−−−−−−QMDFDKKVEGIALWIKNLLSDAEAIKAEKNKLA−−−−DRQKTCENKARNLKEYLSGYL−−−−−CGEKFKTPRVSI−−SYRKS−−ESVEVQDVSKLDEE−−−−−YLK−−−−−−−F−−−−−−−−−−−−−−−−−−−TDPEVDKTKVKK−−−−−ALKDGVE−−−−−−−−−−−−−−−−−−−LSGVVLV−−QNNNIQIR
fig|536231.5.peg.2196   Roseburia intestinalis L1-82     M−−−−−NLFEIENEIMNC−−−−−−−−WD−−−−−−−QETGEILDSDRLDQ−−L−−−−−−EMERDTKIENIALYIKNLTADAEALKAEKQSFA−−−−ERQKAAENKVESLKKYLATYL−−−−−AGQKFSTPRVAI−−SFRKT−−SSVNVTDISQLPEE−−−−−FLK−−−−−−−F−−−−−−−−−−−−−−−−−−−ADPMPDKTAIKA−−−−−AIKAGTS−−−−−−−−−−−−−−−−−−−VAGAEIV−−EGKSMSIK
fig|638302.3.peg.677   Selenomonas flueggei ATCC 43531            LYEIQEDILSC−−−−−−−−ID−−LKTGEI−−−−−IDVERLHG−−L−−−−−−QMERRKKIRNIACWIKNLLADARAYEEEEKTFA−−−−ARKTAAKNKADSLKQYLSDCL−−−−−HGEKIQDREFSV−−GWRKS−−HQVQIDEGAAIPEA−−−−−YLI−−−−−−−P−−−−−−−−−−−−−−−−−−−MPDKVDKQGLKD−−−−−ALKQGCI−−−−−−−−−−−−−−−−−−−FPGIYLR−−EKENIQIK
fig|699218.3.peg.954   Megasphaera genomosp. type_1 str. 28L     M−−−−−NLYEINKSILNCVTIESGENVD−−−−−−−METGEIISAEQLNE−−L−−−−−−KMERAEKIKNIALWVKNLTADATALDNEIKTLT−−−−ARKKAAKNKIDSLKDWLEFNLK−−−−EGEKISEPQYAI−−SWRAS−−ERVKVTNVKELPEE−−−−−FLK−−−−−−−Y−−−−−−−−−−−−−−−−−−−SEPTPDKTGIKK−−−−−AIKAGRE−−−−−−−−−−−−−−−−−−−IKGAELV−−KSNNLQIK
fig|528356.5.peg.768   Neisseria gonorrhoeae PID18            LYRCAADVQAA−−−−−−−−LD−−YYF−−−−DSETEREDTLEA−−V−−−−−−IGQFEVKAQSVIAYIKNQEITEKMLEGHIRRMT−−−−GKLKAVKAQNQSLKDYLARNMQAA−−GITEIKADDGTFKASFRKS−−EAVVILDEAQIPAE−−−−−FMR−−−−E−−A−−−−−−−−−−−−−−−−−−−VKTEPDKTAIRK−−−−−AIESGRQ−−−−−−−−−−−−−−−−−−−VAGAKIE−−GRKNLQIR
fig|242231.10.peg.558   Neisseria gonorrhoeae FA 1090            LYRCAADVQAA−−−−−−−−LD−−YYF−−−−DSETEREDTLEA−−V−−−−−−IGQFEVKAQSVIAYIKNQEITEKMLEGHIRRMT−−−−GKLKAVKAQNQSLKDYLARNMQAA−−GITEIKADDGTFKASFRKS−−EAVVILDEAQIPAE−−−−−FMR−−−−E−−A−−−−−−−−−−−−−−−−−−−VKTEPDKTAIRK−−−−−AIESGRQ−−−−−−−−−−−−−−−−−−−VAGAKIE−−GRKNLQIR
fig|528355.5.peg.854   Neisseria gonorrhoeae PID1            LYRCAADVQAA−−−−−−−−LD−−YYF−−−−DSETEREDTLEA−−V−−−−−−IGQFEVKAQSVIAYIKNQEITEKMLEEHIGRMT−−−−GKLKAVKAQNQSLKDYLARNMQAA−−GITEIKADDGTFKASFRKS−−EAVVILDEAQIPAE−−−−−FMR−−−−E−−A−−−−−−−−−−−−−−−−−−−VKTEPDKTAIRK−−−−−AIESGRQ−−−−−−−−−−−−−−−−−−−VAGAKIE          
fig|528353.5.peg.762   Neisseria gonorrhoeae FA6140            LYRCAADVQAA−−−−−−−−LD−−YYF−−−−DSETEREDTLEA−−V−−−−−−IGQFEVKAQSVIAYIKNQEITEKMLEGHIGRMT−−−−GKLKAVKAQNQSLKDYLARNMQAA−−GITEIKADDGTFKASFRKS−−EAVVILDEAQIPAE−−−−−FMR−−−−E−−A−−−−−−−−−−−−−−−−−−−VKTEPDKTAIRK−−−−−AIESGRQ−−−−−−−−−−−−−−−−−−−VAGAKIE−−GRKNLQIR
fig|528360.6.peg.976   Neisseria gonorrhoeae SK-93-1035            LYRCAADVQAA−−−−−−−−LD−−YYF−−−−DSETEREDTLEA−−V−−−−−−IGQFEVKAQSVIAYIKNQEITEKMLDEHIRQMT−−−−GKLKAVKAQNQSLKDYLARNMQAA−−GITEIKADDGTFKASFRKS−−EAVVILDEAQIPAE−−−−−FMR−−−−E−−A−−−−−−−−−−−−−−−−−−−VKTEPDKTAIRK−−−−−AIESGRQ−−−−−−−−−−−−−−−−−−−VAGAKIE−−E       
fig|528351.3.peg.987   Neisseria gonorrhoeae F62            LYRCAADVQAA−−−−−−−−LD−−YYF−−−−DSETEREDTLEA−−V−−−−−−IGQFEVKAQSVIAYIKNQEITEKMLEGHIRRMT−−−−GKLKAVKAQNQSLKDYLARNMQVA−−GITEIKADDGTFKASFRKS−−EAVVILDEAQIPAE−−−−−FMR−−−−E−−A−−−−−−−−−−−−−−−−−−−VKTEPDKTAIRK−−−−−AIESGRQ−−−−−−−−−−−−−−−−−−−VAGAKIE−−ERKNLQIR
fig|940296.3.peg.1428   Neisseria gonorrhoeae TCDC-NG08107            LYRCAADVQAA−−−−−−−−LD−−YYF−−−−DSETEREDTLEA−−V−−−−−−IGQFEVKAQSVIAYIKNQEITEKMLEEHIGRMT−−−−GKLKAAKARNQSLKDYLARNMQAA−−GITEIKADDGTFKASFRKS−−EAVVILDEAQIPAE−−−−−FMR−−−−E−−A−−−−−−−−−−−−−−−−−−−VKTEPDKTAIRK−−−−−AIESGRQ−−−−−−−−−−−−−−−−−−−VAGAKIE−−GRKNLQIR
fig|940296.3.peg.1895   Neisseria gonorrhoeae TCDC-NG08107            LYRCAADVQAA−−−−−−−−LD−−YYF−−−−DSETEREDTLEA−−V−−−−−−IGQFEVKAQSVIAYIKNQEITEKMLEEHIGRMT−−−−GKLKAAKARNQSLKDYLARNMQAA−−GITEIKADDGTFKASFRKS−−EAVVILDEAQIPAE−−−−−FMR−−−−E−−A−−−−−−−−−−−−−−−−−−−VKTEPDKTAIRK−−−−−AIESGRQ−−−−−−−−−−−−−−−−−−−VAGAKIE−−GRKNLQIR
fig|940296.3.peg.635   Neisseria gonorrhoeae TCDC-NG08107            LYRCAADVQAA−−−−−−−−LD−−YYF−−−−DSETEREDTLEA−−V−−−−−−IGQFEVKAQSVIAYIKNQEITEKMLEEHIGRMT−−−−GKLKAAKARNQSLKDYLARNMQAA−−GITEIKADDGTFKASFRKS−−EAVVILDEAQIPAE−−−−−FMR−−−−E−−A−−−−−−−−−−−−−−−−−−−VKTEPDKTAIRK−−−−−AIESGRQ−−−−−−−−−−−−−−−−−−−VAGAKIE−−GRKNLQIR
fig|528359.7.peg.909   Neisseria gonorrhoeae SK-92-679            LYRCAADVQAA−−−−−−−−LD−−YYF−−−−DSETEREDTLEA−−V−−−−−−IGQFEVKAQSVIAYIKNQEITEKMLEEHIRRMT−−−−GKLKAAKARNQSLKDYLARNMQAA−−GITEIKADDGTFKASFRKS−−EAVVILDEAQIPAE−−−−−FMR−−−−E−−A−−−−−−−−−−−−−−−−−−−VKTEPDKTAIRK−−−−−AIESGRQ−−−−−−−−−−−−−−−−−−−VAGAKIE−−GRKNLQIR
fig|528347.5.peg.787   Neisseria gonorrhoeae DGI18            LYRCAADVQAA−−−−−−−−LD−−YYF−−−−DSETEREDTLEA−−V−−−−−−IGQFEVKAQSVIAYIKNQEITEKMLEGHIRQMT−−−−GKLKAAKARNQSLKDYLARNMQAA−−GITEIKADDGTFKASFRKS−−EAVVILDEAQIPAE−−−−−FMR−−−−E−−A−−−−−−−−−−−−−−−−−−−VKTEPDKTAIKK−−−−−AIESGRQ−−−−−−−−−−−−−−−−−−−VAGAKIE−−GRKNLQIR
fig|242231.10.peg.1933   Neisseria gonorrhoeae FA 1090            LYRCAADVQAA−−−−−−−−LD−−YYF−−−−DSETEREDTLEA−−V−−−−−−IGQFEVKAQSVIAYIKNQEITEKMLEGHIRQMT−−−−GKLKAAKARNQSLKDYLARNMQAA−−GITEIKADDGTFKASFRKS−−EAVVILDEAQIPAE−−−−−FMR−−−−E−−A−−−−−−−−−−−−−−−−−−−VKTEPDKTAIRK−−−−−AIESGRQ−−−−−−−−−−−−−−−−−−−VAGAKIE−−GRKNLQIR
fig|242231.10.peg.1323   Neisseria gonorrhoeae FA 1090                                                  TLEA−−V−−−−−−IGQFEVKAQSVIAYIKNQEITEKMLEGHIRQMT−−−−GKLKAAKARNQSLKDYLARNMQAA−−GITEIKADDGTFKASFRKS−−EAVVILDEAQIPAE−−−−−FMR−−−−E−−A−−−−−−−−−−−−−−−−−−−VKTEPDKTAIRK−−−−−AIESGRQ−−−−−−−−−−−−−−−−−−−VAGAKIE−−GRKNLQIR
fig|528358.6.peg.945   Neisseria gonorrhoeae PID332                                                                                      MLEGHIGRMT−−−−GKLKAAKARNQSLKDYLARNMQAA−−GITEIKADDGTFKASFRKS−−EAVVILDEAQIPAE−−−−−FMR−−−−E−−A−−−−−−−−−−−−−−−−−−−VKTEPDKTAIRK−−−−−AIESGRE−−−−−−−−−−−−−−−−−−−VAGAKIE−−ERKNLQIR
fig|528352.5.peg.1842   Neisseria gonorrhoeae FA19                                                EGTLEA−−V−−−−−−IGQFEVKAQSVIAYIKNQEITEKMLEGHIGRMT−−−−GKLKAVKAQNQSLKDYLARNMQAA−−GITEIKADDGTFKASFRKS−−EAVGILDEAQIPAE−−−−−FMR−−−−E−−A−−−−−−−−−−−−−−−−−−−VKTEPDKTAIRK−−−−−AIESGRE−−−−−−−−−−−−−−−−−−−VAGAKIE−−ERQNLQIR
fig|586220.3.peg.124   Leuconostoc mesenteroides subsp. cremoris ATCC 19254            LSELTDFEIKL−−−−−−−−KK−−MLEDEEIDTQTFEDTVAS−−L−−−−−−−−DKDAKIDGLYSVATNIQETIDILTARIKMNQ−−−−ERVKSEKKSLERLLNYVVFVMEKA−−GVKELRTHTSLF−−TTRRS−−VAVEIDPETSRIPDE−−−−−FIN−−−−V−−K−−−−−−−−−−−−−−−−−−−ETKIPNKAKLKA−−−−−FINTGGK−−−−−−−−−−−−−−−−−−−VKGVAVI−−ERTHAQVK
fig|272563.8.peg.957   Clostridium difficile 630            LYELTTDLLEI−−−−−−−−EE−−GLTEITGNEAEKLEEIKEI−−I−−−−−−KQEIQNKNTRIVSVIINIDSDINSIDSEIKRLQ−−−−ELKRVKKNTIDRLKSNIKDCMELL−−GTKKVETILGNI−−SIRKSAGSLVIEDEEKIPAI−−−−−YKT−−−−V−−E−−−−−−−−−−−−−−−−−−−QVVKVDKNSIKD−−−−−FIKKGHE−−−−−−−−−−−−−−−−−−−VEGCRIE−−YGTTLTI 
fig|1496.1.peg.3260   Clostridium difficile 630                                                                          MSVIINIDSDINSIDSEIKRLQ−−−−ELKRVKKNTIDRLKSNIKDCMELL−−GTKKVETILGNI−−SIRKSAGSLVIEDEEKIPAI−−−−−YKT−−−−V−−E−−−−−−−−−−−−−−−−−−−QVVKVDKNSIKD−−−−−FIKKGHE−−−−−−−−−−−−−−−−−−−VEGCRIE−−YGTTLTI 
fig|1121308.3.peg.1647   Clostridium difficile ATCC 9689            LYELTTDLLEI−−−−−−−−EE−−GLTETTGNEAEKLEEIKEI−−I−−−−−−KQEIQNKNTRIVSVILNIDSDINSIDSEIKRLQ−−−−ELKRVKKNTLDRLKSNIKDCMELL−−GTKKVETVLGNI−−SIRKSAGSLVIEDEEKIPAI−−−−−YKT−−−−V−−E−−−−−−−−−−−−−−−−−−−QVVKVDKNTIKD−−−−−FIKKGHE−−−−−−−−−−−−−−−−−−−VEGCRIE−−YSTTLT  
fig|1496.1.peg.561   Clostridium difficile 630                                                                          MSVIINIDSDINSIDLEIKRLQ−−−−ELKKVKKNNLDRLKSNIKECMELL−−GTKKIETVLGNI−−SIRKSAGSLVIEDEEKIPAI−−−−−YKT−−−−V−−E−−−−−−−−−−−−−−−−−−−QVVKVDKNSIKD−−−−−FIKKGHE−−−−−−−−−−−−−−−−−−−VEGCRIE−−YGTTLTI 
fig|272563.8.peg.3087   Clostridium difficile 630            LYELTTDLLEI−−−−−−−−EE−−GLTEITGNEAEKLEEIKEI−−I−−−−−−KQEIQNKNTRIVSVIINIDSDINSIDLEIKRLQ−−−−ELKKVKKNNLDRLKSNIKECMELL−−GTKKIETVLGNI−−SIRKSAGSLVIEDEEKIPAI−−−−−YKT−−−−V−−E−−−−−−−−−−−−−−−−−−−QVVKVDKNSIKD−−−−−FIKKGHE−−−−−−−−−−−−−−−−−−−VEGCRIE−−YGTTLTI 
fig|500633.7.peg.1192   Clostridium hiranonis DSM 13275                                                        I−−−−−−DLEINNKSESMLYILRNIQSDIEAIDGEIKRLQ−−−−ALKKNKQNSMNKLKTLIKECLEKL−−GKKRLETSLGNL−−TVRNNPDSINVLDETLVPEE−−−−−FVK−−−−V−−E−−−−−−−−−−−−−−−−−−−VVKKVDKKKIKD−−−−−WLNETGEV−−−−−−−−−−−−−−−−−−−VPGTEVL−−KTTSLIV 
fig|469604.3.peg.1780   Fusobacterium sp. 3_1_36A2     M−−−−−KVYEIIGAMEDT−−−−−−−−LDIFLESEGAESDKENYDYVMEF−−L−−−−−−KEELNNKSSSILKYIRNLEADSKIAKDEADRLD−−−−NLSKSKMNKVKKLKEYLINIMQYL−−DKKKIETDLGSY−−GIRNS−−TKVDVYDMTLLPSE−−−−−FMR−−−−V−−K−−−−−−−−−−−−−−−−−−−EEVTPDKEKIAD−−−−−YIKKNGE−−−−−−−−−−−−−−−−−−−LNGARIV−−TGYSLQIR
fig|469604.7.peg.1688   Fusobacterium nucleatum subsp. vincentii 3_1_36A2     M−−−−−KVYEIIGAMEDT−−−−−−−−LDIFLESEGAESDKENYDYVMEF−−L−−−−−−KEELNNKSSSILKYIRNLEADSKIAKDEADRLD−−−−NLSKSKMNKVKKLKEYLINIMQYL−−DKKKIETDLGSY−−GIRNS−−TKVDVYDMTLLPSE−−−−−FMR−−−−V−−K−−−−−−−−−−−−−−−−−−−EEVTPDKEKIAD−−−−−YIKKNGE−−−−−−−−−−−−−−−−−−−LNGARIV−−TGYSLQIR
fig|469616.3.peg.2084   Fusobacterium mortiferum ATCC 9817     M−−−−−KAYEIKNAMIDT−−−−−−−−LDIFLESNKDEMDKENYDDVMEY−−L−−−−−−REELESKSSNIVRYIRNLELENIVAKTEIDRLE−−−−ELKKSREKKITSLKGYIKGILLEL−−DKKKIETDLGNL−−SLRKT−−TSVEIIDLSKIPKE−−−−−YLT−−−−V−−K−−−−−−−−−−−−−−−−−−−EEIKPAKNLISE−−−−−SLKKNIA−−−−−−−−−−−−−−−−−−−VSGAILK−−EDYLLKIK
fig|546275.3.peg.1741   Fusobacterium periodonticum ATCC 33693     M−−−−−KLYEITSEMRALDELFLSC−−−−−IDEETGEVKDDGVIDILEQEL−−−−−−KLQLQTKGAGIIKSFKNSEAMLNGVDEEIKRLQ−−−−ALKKSISNQINSRKEYIVRNMEMM−−GITKIETELGNL−−SLRKS−−KSVNIYDESLIDKK−−−−−FIE−−−−I−−E−−−−−−−−−−−−−−−−−−−TKEKISKTEIKK−−−−−AIEAGEN−−−−−−−−−−−−−−−−−−−VQGANIV−−EKNSLNIK
fig|556264.3.peg.1442   Fusobacterium sp. D11     M−−−−−KLYEITKEMRALDELFLSC−−−−−IDEETGEVKDDGVIDILEQEL−−−−−−KIQLQTKGAGIIKSFKNSEAMLNGVDEEIKRLQ−−−−ALKKSISNQINSRKEYIVRNMEIM−−GITKIETELGNL−−SLRKS−−KSVNIYDESLIDKK−−−−−FIE−−−−I−−E−−−−−−−−−−−−−−−−−−−TKEKISKTEIKK−−−−−AIEAGEN−−−−−−−−−−−−−−−−−−−VQGANIV−−EKNSLNIK
fig|469605.7.peg.1614   Fusobacterium gonidiaformans 3-1-5R     L−−−−−SLYQITEEMEALDSLYWENID−−EETGEIKNAEVLEEFEKE−−I−−−−−−KNLLSSKGAQIIASQRQSKLFIEAAKSEIERLT−−−−KLKKSLERKEEFYKNYIIRSMEKA−−NLIEIKTEIGKI−−KLTSGKGKVEIYDLGLLDDK−−−−−FFK−−−−−−−−−−−−−−−−−−−−−−−−−−−IKKEPMKTEIRE−−−−−ALKAGLE−−−−−−−−−−−−−−−−−−−VQGAKMI−−YENGLSIK
fig|457405.3.peg.1580   Fusobacterium sp. 7_1     M−−−−−KFYDVAKDYIERMEYLEQGIN−−SETGEMTDNSNQLAIWTDE−−L−−−−−−TKDLKDKSANVIAVVRNQELTIEALDTEIERLK−−−−AMKDSIEKKLDKFKCYIKSAMVVN−−GIEKIETPIGNI−−KFTKS−−TAVEIYDEKLIDKK−−−−−FIK−−−−I−−E−−−−−−−−−−−−−−−−−−−TKEKISKTDIKN−−−−−ALKAGEE−−−−−−−−−−−−−−−−−−−VQGARLV−−ENKNLKI 
fig|469604.3.peg.389   Fusobacterium sp. 3_1_36A2           KFYDVVNDYIERMEYLEQGIN−−SETGEMTDNSNQLAIWTDE−−L−−−−−−TKDLKDKSANVIAVVRNQELTIEALDTEIERLK−−−−AMKDSIEKKLDKFKCYIKSAMVVN−−GIEKIETPIGNI−−KFTKS−−TAVEIYDEKLIDKK−−−−−FIK−−−−I−−E−−−−−−−−−−−−−−−−−−−TKEKISKTDIKN−−−−−ALKAGEE−−−−−−−−−−−−−−−−−−−VQGARLV−−ENKNLKI 
fig|469604.7.peg.1124   Fusobacterium nucleatum subsp. vincentii 3_1_36A2           KFYDVVNDYIERMEYLEQGIN−−SETGEMTDNSNQLAIWTDE−−L−−−−−−TKDLKDKSANVIAVVRNQELTIEALDTEIERLK−−−−AMKDSIEKKLDKFKCYIKSAMVVN−−GIEKIETPIGNI−−KFTKS−−TAVEIYDEKLIDKK−−−−−FIK−−−−I−−E−−−−−−−−−−−−−−−−−−−TKEKISKTDIKN−−−−−ALKAGEE−−−−−−−−−−−−−−−−−−−VQGARLV−−ENKNLKI 
fig|469604.3.peg.1423   Fusobacterium sp. 3_1_36A2           KFYDVVNDYIERMEYLEQGIN−−AETGEMSDDGTQLAIWTAE−−L−−−−−−TQDLKDKSANVIAVVRNQELTIEALDNEIERLK−−−−AMKDSIKKKLDKFKTYIKSSMLVN−−NIEKIETPLGNI−−KFTKS−−TTTEIYDESLIDSR−−−−−FIE−−−−V−−V−−−−−−−−−−−−−−−−−−−TTEKISKEKIKA−−−−−ALKAGEE−−−−−−−−−−−−−−−−−−−VQGARLV−−ENKNLKI 
fig|469604.7.peg.839   Fusobacterium nucleatum subsp. vincentii 3_1_36A2           KFYDVVNDYIERMEYLEQGIN−−AETGEMSDDGTQLAIWTAE−−L−−−−−−TQDLKDKSANVIAVVRNQELTIEALDNEIERLK−−−−AM