(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00013282

fig|198215.6.peg.997   Shigella flexneri 2a str. 2457T                          YSAPAPHKTGAGIATPTMTTAHNRAQ−−AVFL−−−−−−−−−−−−−−−−−−−−−−−−−−−−CVKHSHIQIMVGRAGQPQGWPVSVVTGCSNPVRLTTHEIATSGGESFKLTIEAAIMATILTLSHP                                                                      
fig|198215.1.peg.835   Shigella flexneri 2a str. 2457T                          YSAPAPHKTGAGIATPTMTTAHNRAQ−−AVFL−−−−−−−−−−−−−−−−−−−−−−−−−−−−CVKHSHIQIMVGRAGQPQGWPVSVVTGCSNPVRLTTHEIATSGGESFKLTIEAAIMATILTLSHP                                                                      
fig|373384.10.peg.835   Shigella flexneri 5 str. 8401                          YSAPAPHKTGAGIATPTMTTAHNRAQ−−AVFL−−−−−−−−−−−−−−−−−−−−−−−−−−−−CVKHSHIQIMVGRAGQPQGWPVSVVTGCSNPVRLTTHEIATSGGESFKLTIEAAIMATILTLSHPDATIENGRAVTTSVAVAKFFRKMHKNVIQKIETLECSREFNRLNFKPVTYT−−−−DAKGEKRPMYQITK 
fig|766154.3.peg.3806   Shigella flexneri 1235-66                          YSAPAPHKTGAGIATPTMTTAHNRAQ−−AVFL−−−−−−−−−−−−−−−−−−−−−−−−−−−−CVKHSHIQIMVGRAGQPQGWPVSVVTGCSNPVRLTTHEIATSGGESFKLTIEAAIMATILTLSHPDATIENGRAVTTSVAVAEFFRKMHKNVIQKIETLECSPEFNRLNFKPVTYT−−−−DAKGEKRPMYQITK 
fig|766157.3.peg.3070   Shigella flexneri 2747-71                          YSAPAPHKTGAGIATPTMTTAHNRAQ−−AVFL−−−−−−−−−−−−−−−−−−−−−−−−−−−−CVKHSHIQIMVGRAGQPQGWPVSVVTGCSNPVRLTTHEIATSGGESFKLTIEAAIMATILTLSHPDATIENGRAVTTSVAVAEFFRKMHKNVIQKIETLECSPEFNRLNFKPVTYT−−−−DAKGEKRPMYQITK 
fig|766161.3.peg.1094   Shigella flexneri 6603-63                          YSAPAPHKTGAGIATPTMTTAHNRAQ−−AVFL−−−−−−−−−−−−−−−−−−−−−−−−−−−−CVKHSHIQIMVGRAGQPQGWPVSVVTGCSNPVRLTTHEIATSGGESFKLTIEAAIMATILTLSHPDATIENGRAVTTSVAVAEFFRKMHKNVIQKIETLECSPEFNRLNFKPVTYT−−−−DAKGEKRPMYQITK 
fig|198214.1.peg.845   Shigella flexneri 2a str. 301                          YSAPAPHKTGAGIATPTMTTAHNRAQ−−AVFL−−−−−−−−−−−−−−−−−−−−−−−−−−−−CVKHSHIQIMVGRAGQPQGWPVSVVTGCSNPVRLTTHEIATSGGESFKLTIEAAIMATILTLSHPDATIENGRAVTTSVAVAEFFRKMHKNVIQKIETLECSPEFNRLNFKPVTYT−−−−DAKGEKRPMYQITK 
fig|216599.1.peg.1307   Shigella sonnei 53G                          YSAPAPHKTGAGIATPKSFTAHNRAQ−−AVFL−−−−−−−−−−−−−−−−−−−−−−−−−−−−CVMHSHIQIMVGRAGQSQDWPGSVMTGCSNPVRLTTHEIATSGGELIKFIAEAAIMAT−−TLSHPCVTVENGRAVTTSVAVAEFFHKRHDNVLRAIANIECSDKFTALNFEASEYT−−−−DSIGRKLPMYQITK 
fig|754077.4.peg.5508   Shigella sonnei str. Moseley                          YSAPAPHKTGAGIATPKSFTAHNRAQ−−AVFL−−−−−−−−−−−−−−−−−−−−−−−−−−−−CVMHSHIQIMVGRAGQSQDWPGSVMTGCSNPVRLTTHEIATSGGELIKFIAEAAIMAT−−TLSHPCVTVENGRAVTTSVAVAEFFHKRHDNVLRAIANIECSDKFTALNFEASEYT−−−−DSIGRKLPMYQITK 
fig|344610.3.peg.3327   Escherichia coli 53638                          YSAPAPHKTGAGIATPKSFTAHNRAQ−−AVFL−−−−−−−−−−−−−−−−−−−−−−−−−−−−CVMHSHIQIMVGRAGQSQDWPGSVMTGCSNPVRLTTHEIATSGGELIKFIAEAAIMAT−−TLSHPCVTVENGRAVTTSVAVAEFFHKRHDNVLRAIANIECSDKFTALNFEASEYT−−−−DSTGRKLPMYQITK 
fig|344609.3.peg.4104   Shigella boydii BS512                          YSVPAPHKTGAGISTPKVTRAHNRAE−−AVFL−−−−−−−−−−−−−−−−−−−−−−−−−−−−CVMHSHIQIMVRRAGQPQGWPGSRVTGSANPVRLTTHEISTSAGELINLSLEDVIMAT−−TLSHPDVTI                                                                  
fig|198214.1.peg.1316   Shigella flexneri 2a str. 301                          YSASAPHKTGAGRGNPNVTRAHSRAE−−AVFL−−−−−−−−−−−−−−−−−−−−−−−−−−−−CVMHSSIQIMVGCAGQSQDWPGSRVTGISTPVRLTTLMVVENLGGELINLSLEDAIMATIPALSHPDVTIENGRAVTTSVAVAEFFHKRHDNVLRAIANTECSPEFNALNFEDVTYT−−−−DTKGEKRPMYQITK 
fig|766161.3.peg.2227   Shigella flexneri 6603-63                          YSASAPHKTGAGRGNPNVTRAHSRAE−−AVFL−−−−−−−−−−−−−−−−−−−−−−−−−−−−CVMHSSIQIMVGCAGQSQDWPGSRVTGISTPVRLTTLMVVENLGGELINLSLEDAIMATIPALSHPDVTIENGRAVTTSVAVAEFFHKRHDNVLRAIANTECSPEFNALNFEDVTYT−−−−DTKGEKRPMYQITK 
fig|216599.1.peg.4646   Shigella sonnei 53G                          YSAPAPYKTGAGRGNPNVTRAHSRAE−−AVFL−−−−−−−−−−−−−−−−−−−−−−−−−−−−CVMHSSIQIMVGCAGQSQDWPGSRVTGISTPVRLTTLMVVENLGGELINLSLEDAIMATIPALSHPDVTIENGRAVTTSIAIAEFFGKRHDNVLRAIANTECSPEFNALNFEDVTYT−−−−DAKGEKRPMYQITK 
fig|754077.4.peg.2061   Shigella sonnei str. Moseley                          YSAPAPYKTGAGRGNPNVTRAHSRAE−−AVFL−−−−−−−−−−−−−−−−−−−−−−−−−−−−CVMHSSIQIMVGCAGQSQDWPGSRVTGISTPVRLTTLMVVENLGGELINLSLEDAIMATIPALSHPDVTIENGRAVTTSIAIAEFFGKRHDNVLRAIANTECSPEFNALNFEDVTYT−−−−DAKGEKRPMYQITK 
fig|344610.3.peg.4958   Escherichia coli 53638                          YSAPAPYKTGAGRGNPNVTRAHSRAE−−AVFL−−−−−−−−−−−−−−−−−−−−−−−−−−−−CVMHSSIQIMVGCAGQSQDWPGSRVTGISTPVRLTTLMVVENLGGELINLSLEDAIMATIPALSHPDVTIENGRAVTTSIAIAEFFGKRHDNVLRAIANTECSPEFNALNFEDVTYT−−−−DAKGEKRPMYQITK 
fig|1182702.3.peg.1878   Escherichia coli KTE103                          YSAPAPHKTGAGRGNPEFNQAHNRAQ−−AVFL−−−−−−−−−−−−−−−−−−−−−−−−−−−−CVKHSHIQIMVGRAGQLQGWPDSWLTGISTPVRLTTLMVVENLGGELLILNQEAAIMATIPTLSHPDVTIENGRAVTTSVAVAEFFRKMHKDVLRKIETLECSEDFNERNFTPVTYT−−−−DAKGEKRPMYQITK 
fig|1182717.3.peg.3900   Escherichia coli KTE134                          YSAPAPHKTGAGRGNPEFNQAHNRAQ−−AVFL−−−−−−−−−−−−−−−−−−−−−−−−−−−−CVKHSHIQIMVGRAGQLQGWPDSWLTGISTPVRLTTLMVVENLGGELLILNQEAAIMATIPTLSHPDVTIENGRAVTTSVAVAEFFRKMHKDVLRKIETLECSEDFNERNFTPVTYT−−−−DAKGEKRPMYQITK 
fig|656379.3.peg.1975   Escherichia coli FVEC1302                          YSAPAPHKTGAGRGNPEFNQAHNRAQ−−AVFL−−−−−−−−−−−−−−−−−−−−−−−−−−−−CVKHSHIQIMVGRAGQLQGWPDSWLTGISTPVRLTTLMVVENLGGELLILNQEAAIMATIPTLSHPDVTIENGRAVTTSVAVAEFFRKMHKDVLRKIETLECSEDFNERNFTPVTYT−−−−DAKGEKRPMYQITK 
fig|331111.3.peg.3876   Escherichia coli E24377A                          YSAPAPHKTGAGRGNPMFTNAHNRAQ−−AVFL−−−−−−−−−−−−−−−−−−−−−−−−−−−−CVMHSHIQIMVGRAGQPQGWPGSLVTGISTPVRLTTLMVVENLGGELIKFTNEAAIMATIPTLSQPDVTIENGRAVTTSVAIAEFFGKRHDNVIQKIKLLDCSPEFTALNFKVSEYT−−−−DSTGRKLPMYQITK 
fig|216592.1.peg.1692   Escherichia coli 042                          YSAPAPHKTGAGRGNPKSFTAHNRAQ−−AVFL−−−−−−−−−−−−−−−−−−−−−−−−−−−−CVKHSHIRIMVGRAGQPQGWPGSVMTGISTPVRLTTLMVVENLGGELIKFIAEAAIMATILTLSHPDVTIENGRAVTTSVAIAEFFGKRHERVLDKIRNLDCSAKFTEHNFVSSEYT−−−−DSTGRKLPMYQITK 
fig|868193.3.peg.3102   Escherichia coli DEC12C                         RYTAQAPYKAGAGRGNPKFNIEHNRAH−−AVFS−−−−−−−−−−−−−−−−−−−−−−−−−−−−CHEHRYAQIMVGRAGPTSVGPGSMLTGISTPVRLTTYMVVESLGGEFIEFNIGAVTMTTLPTQSHPEITIINGRVVTTSLAVANYFTKRHERVLDRIRNLECSAEFTEHNFVLSEYT−−−−DASGRKLPCYQITR 
fig|358709.5.peg.1761   Escherichia coli 101-1                         RYTVQAPYKAGAGRGNPEFTKAHNRAL−−AVFL−−−−−−−−−−−−−−−−−−−−−−−−−−−−CNEQHYAQIMVGRAGPTSVGPGSLVTGISTPVRLTTNKVVESLGGELLKITKEAAIMATIPTLTQPEIAIVDGQAVTSSLAVANFFSKRHDDVLKKIRTLECSASFTARNFSVSDYT−−−−DCTGRKLPCYQITR 
fig|573235.3.peg.3777   Escherichia coli O26:H11 str. 11368                         RYTVQAPYKAGAGRGNPEFTKAHNRAL−−AVFL−−−−−−−−−−−−−−−−−−−−−−−−−−−−CHEQHYAQIMVGRAGPTSVGPGSLVTGISTPVRLTTNKVVESLGGELLKITKEAAIMATIPTLTQPEIAIVDGQAVTSSLAVANFFSKRHDDVLKKIRTLECSASFTARNFSVSDYT−−−−DCTGRKLPCYQITR 
fig|1169328.3.peg.4962   Escherichia coli KTE8                         RYTVQAPYKAGAGRGNPEFTKAHNRAL−−AVFL−−−−−−−−−−−−−−−−−−−−−−−−−−−−CHEQHYAQIMVGRAGPTSVGPGSLVTGISTPVRLTTNKVVESLGGELLKITKEAAIMATIPTLTQPEIAIVDGQAVTSSLAVANFFSKRHDDVLKKIRTLECSASFTARNFSVSDYT−−−−DCTGRKLPCYQITR 
fig|340185.3.peg.5239   Escherichia coli E22                         RYTVQAPYKAGAGIGVLKLSTAMYDAP−−ASFL−−−−−−−−−−−−−−−−−−−−−−−−−−−−SSAFAHIQIMVGWAGAPKGAPVSVDAGYANPVQFTTSEIGVSGGGSFSLSTEAAIMATIQALTQPEITIDNGQAVTTSLAVANFFSKRHDDVLKKIRTLDCSPEFCARNFAETSISVNQPNGGTRKLPCYQITR 
fig|344610.3.peg.4980   Escherichia coli 53638                         RYTVSAPYKAGAGICTPELSTAIYDAP−−ASFL−−−−−−−−−−−−−−−−−−−−−−−−−−−−SSALTHARIMVGWAGEPKGSPVSVDAGSANPVQSATSEICTSGGGSFPQSTEAAIMATVPTHS                                                                        
fig|1181732.3.peg.771   Escherichia coli KTE186                   HLSKKAAYTEAIPYKTGIGIGLPLELEAIHDAP−−ASFF−−−−−−−−−−−−−−−−−−−−−−−−−−−−VSAHTHTSTMVGCMELPSGRLVSSNTSKANSVQSTASKIGLLGGGYNPKVRGAFHMAVS−−−ARPYFVW−−−−−−−RFMQCLTG−−−−SIAIFTVTA−−−−ATEREARAQLPHAH−−−−−LIFVARIRQEVTHA
fig|585397.7.peg.3322   Escherichia coli ED1a                   HLSKKAAYTEAIPYKTGIGIGLPLELEAIHDAP−−ASFF−−−−−−−−−−−−−−−−−−−−−−−−−−−−VSAHTHTSTMVGCMELPSGRLVSSNTSKANSVQSTASKIGLLGGGYNPKVRGAFHMAVS−−−ARPYFVW−−−−−−−RFMQCLTG−−−−SIAIFTVTA−−−−ATEREARAQLPHAH−−−−−LIFVARIRQEVTHA
fig|382245.6.peg.2737   Aeromonas salmonicida subsp. salmonicida A449                 GLPDNSQEGTILSATAKSVAEIGVSQRILEPTHAL−−AWFFVGARSSFLGALLA−−−−−−−−−−−−−−−YPVSSLYSVMAVRVRAPQGALDSKVSSYANLVRAATRRLASLCGSNKRLTLEAAIMATVPTPATSKIF−−−−−−−−TFLIASNSCRLADLSRIRTISAMADTEVQARAALAGLP−−−−−LVFVSRRPSGEVA  
fig|344609.11.peg.4468   Shigella boydii CDC 3083-94                   HLAEKSCYSSSVAAKSATGRGNPNTLRATQTPK−−ASFFVSDHYAHQ−−−−−−−−−−−−−−−−−−−−ISGLVRTVSMVALVGLRSRRPVSFVSGISTPANVTAISERGNSGGDSLNTKEAAAMLATTPTQKPQFIW−−−−−−−IIAAVRRDCPTITAKIHHIAA−−−−ESERDARRSLVRDHV−−−−CFFAGRIRMEV    
fig|573395.3.peg.348   Salmonella enterica subsp. enterica serovar Tennessee str. CDC07-0191                  LPTIANPVYGYSAPAKSGAGIGVPITCIVPTRTK−−RVFL−−−−−−−−−−−−−−−−−−−−−−−−−−−−SAKFLRTQIMVGWMRLPKGRPVSIQAGYANLVQLTTSLRLASLGGEFKIHCIEAAIMATTPTQNPQFIW−−−−−−−LIAAVRRDMPTITPKIHHIAA−−−−ESEHEARRTLARDHV−−−−CFFAGRIRLEVA   
fig|667127.3.peg.2254   Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884                 GLMCPAIPVYGYSAPAKSGAGIGVLVKLSAIHDAP−−SVFFCVVSSVHPFFSGS−−−−−−−−−−−−−−−VSFRTCIRIMVGWAGASSEAPVSDNAGYANPVQSITSEIGVSGDGFNPQLSEAATCWLLPLPKNRNLSGLSP−−−−LFAAICRQLKPKSI                                             
fig|216592.1.peg.937   Escherichia coli 042                  LPLCGNTVYGYKAPHKTGAGIGVLVNRMATYDAP−−SVFFYVVGLTHPFFGRW−−−−−−−−−−−−−−−CIIQRLCQSMVAQAGASSEAPVSIRAGYANPVWATTSEIGVSGGSVTCYRMEAATCWLLPLPKNRNLSGLSP−−−−QFAAIAR                                                    
fig|521000.6.peg.70   Providencia rettgeri DSM 1131                  LPLLAAIGYSEKALAKSSVGFRSLNLVKATHDAP−−SVFFCVHVYAHLL−−−−−−−−−−−−−−−−−−−NAVLYRAESMVALAGQPSGWLVSFTTSTANPVNVTTLNEFRSSRGDSYDNVKEIIFMMAIPTQTHSKFIF−−−−−−−−−LAVKRSDTAAKPCRIETSA−−−−PNERTARLSLARDYV−−−−LLFAGHIPAKAVAH 
fig|572265.5.peg.1007   Hamiltonella defensa 5AT (Acyrthosiphon pisum)                  LPVWANFAYSHHALVNPSDGFRSLSIHKATVDAVD−−SVFFYVVDNAH−−−−−−−−−−−−−−−−−−−−−−−−−−−QYSMVALSGQSSDWLVSLCTSTANLDIVTAHYEFRSSSGDFLNKHKEIASMATIPSHTHPEFI                                                                   
fig|374931.9.peg.787   Haemophilus influenzae PittGG            PFLQNGLTDKTRLNYINLALAKSRAGRDKLNILQANDSTPFNRAFFVRSVYASIQN−−−−−−−−−−−−−−−−−−NLSFDRLFSMVARNGQPLAVGCFPVKAVCHPVTCYR−−−−−−−−−−−−−PTVTSLAVVPKNYLQDTAEMIY−−−−−−−KFLCINRTHPHFNLCIQTIHA−−−−NTEESARLSLNADFR−−−HLVTVAKI        
fig|454169.6.peg.2663   Salmonella enterica subsp. enterica serovar Heidelberg str. SL476                  LPHQECTGYSLKVAAKSAAGRRNPCYLKAILHAP−−GVFFCVAALTHLKFMVWWL−−−−−−−−IVFFYFLRHIISIMVVQAGQLSGWPVSFRAGIPTPVWATTHERRNSGGSVTRYLKEVAIMATVPALSHPEFTF−−−−−−−VFLAVRRTDRDARPRPVRVIA−−−−DCEHAARLKLATEFI−−−−LSFAARIPVK     
fig|431946.3.peg.2330   Escherichia coli SE15                  LPHQECAGYSLKVAAKSAAGRRNPCYLKAILHAL−−GVFFCVAALTHLKFMVWWL−−−−−−−−IVFFYFLRHIIRIMVVQAGQLSGWPVSFRAGIPTPVWATTHERRNSGGSVTRYLKEVAIMATVPALSHPEFTF−−−−−−−VFLAVRRTDRDARPRPVRVIA−−−−ECEHAARLKLATEFI−−−−LSFAARIPVK     
fig|349967.3.peg.727   Yersinia mollaretii ATCC 43969     TLIP−−QKGLFSGLHLLQALRYSHRAAAKSAVGRRNPCYLLATQHAP−−CVFFYVVASAYQFFTQW−−−−−−−−−−−−−−FLYRCRYRAMVAQAGQPSGWPVSNKAGIPTPVWATTHKCRNFGGSNNQYLLEAATMATSLTPLHPQFIY−−−−−−−LFAVVRRTELTARPCMLRTTA−−−−SSEKNARLRLTRDYI−−−−LSFAGRLPLGEVA  
fig|349966.3.peg.2460   Yersinia frederiksenii ATCC 33641     TLIP−−QKGLFSGLHFLQALRYSRRAAAKSAAGRENPCNSMATQHAP−−GVFFYVVASAYQFFAQW−−−−−−−−−−−−−−FLHRCRYQAMVAQAGQLSGWPVSIEAGFSPPSGLPPKCENSSGSNNHDSMEAATMATSLTPLHPQFIY−−−−−−−LFAAVRRTELTARPCMLRTIA−−−−SSEKNARLRLTRDYI−−−−LSFAGRLPLGEVA  
fig|478008.5.peg.3720   Escherichia coli O157:H7 str. EC869     MMIPAYIKYLYSGLLTVVISRYSFSAVAKSAAGIGVPYNLLATIDAP−−CVFFYVVAQAQPFSGLWCL−−−−−−−−−−−−CLHHGSIEIMVVRAGQPSGWPVSNKAGYANPVRAATSEIGVSGGSNNRYLLEAAIMATILTPSHPQYVF−−−−−−−VFAAIRRADTHPRICMLRTVS−−−−CDERSARRLLVRDYV−−−−LSLSARLPAGEVTL 
fig|701177.3.peg.348   Escherichia coli O55:H7 str. CB9615     MMIPAYIKYLYSGLLTVVISRYSFSAVAKSAAGIGVPYNLLATIDAP−−CVFFYVVAQAQPFSGLWCL−−−−−−−−−−−−CLHHGSIEIMVVRAGQPSGWPVSNKAGYANPVRAATSEIGVSGGSNNRYLLEAAIMATILTPSHPQYVF−−−−−−−VFAAIRRADTQPRICMLRTVS−−−−CDERSARRLLVRDYV−−−−LSLSARLPAGEVTL 
fig|500638.3.peg.1391   Edwardsiella tarda ATCC 23685     MMIPEYNKYLFSGLLTVVISRYSFSAVAKSTAGIGVPRNSMATPDAP−−GVFFFVVAQAHPFSGLWCL−−−−−−−−−−−−CLHRSSFEIMAVRAGQPSGWPVSIEAGYANPVRAATSEIGVSGGSNNRYSMEAAIMATILTPSYPQYVF−−−−−−−VFAAIRRADTQPRICMLRTVA−−−−CDERSARRSLVRDYV−−−−LSLSARLPAGEVTL 
fig|295319.3.peg.3774   Salmonella enterica subsp. enterica serovar Paratypi A str. ATCC 9150     MIQR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FICLWILRVMVAQAGASHEAPVSNVAGYANPVWATTSEIGVSSGSSHMQTLEVATMATTLTTSHSQFVF−−−−−−−VFAAVRRADRKPRICMLRTVA−−−−GDEHAARLSLVRDYV−−−−LSFAGRLPVAE    
fig|344610.3.peg.2486   Escherichia coli 53638     MMMPVLQKVPFSGLPFSGICGYSFSAAAKSAAGRRNPSYFKATYDAP−−CVFFYVVASAH−−−LFFW−−−−−−−−−−−−LWFLNRSLCQIMVVRAGQPSGWPVSLKAGIPTPVRATTHERRNSSGSCNCYFKEAAIMATTLTPSHPEFVF−−−−−−−VFAAVRRADRHPRICMLRTVA−−−−GDERSARRSLVRDYV−−−−LSLAARLPVMGVSRA
fig|216592.1.peg.982   Escherichia coli 042     MMMPALQKVPFSGLPFSGICGYSFSAAAKSAAGRRNPCNSKATYDAP−−CVFFCVAINATERQIMVWRVVCRAG−−−MILFAIACYATESMVAQAGQPPGWPVFFEAGIPTPVWAIAIERRNSGDSSYLLLEGGCLMATTLTPSHPEFVF−−−−−−−VFAAVRRADRHPRICMLRTVA−−−−GDERSARRSLVRDYV−−−−LSLAARLPVVEVSRA
fig|340186.3.peg.4126   Escherichia coli E110019     MMMPALQKLPFSGLPFSGICGYSFSAAAKSAAGRGNPSNSQATYDAP−−CVFFCVAINATERQIMVWCVVSRADGIPCILPASAHYAAESMVAQAGQPPGWPVSCEAGISTPVWAIAIERGNSGDSVICYSQEAAIMATTLTPSHPEFVF−−−−−−−VFAAVRRADRHPRICMLRTVA−−−−GDERSARRSLVRDYV−−−−LSLAARLPVVEVSRA
fig|478008.5.peg.906   Escherichia coli O157:H7 str. EC869     MMMPALQKLPFSGLPFSGICGYSFSAAAKSAAGRGNPSNSQATYDAP−−CVFFCVAINATERQIMVWCVVSRADGIPCILPASAHYAAESMVAQAGQPPGWPVSCEAGISTPVWAIAIERGNSGDSVICYSQEAAIMATTLTPSHPEFVF−−−−−−−VFAAVRRADRHPRICMLRTVA−−−−GDERSARRSLVRDYV−−−−LSLAARLPVMGVSRA
fig|868186.3.peg.4916   Escherichia coli DEC11A     MMMPVLQKVPFSGLPFSGICGYSFSAAAKSAAGRGNPSNSQATYDAP−−CVFFCVAINATERQIMVWCVVSRADGIPCILPASAHYAAESMVAQAGQPPGWPVSCEAGISTPVWAIAIERGNSGDSVICYSQEAAIMATTLTPSHPEFVF−−−−−−−VFAAVRRTDRHPRICMLRTVA−−−−GDERSARRSLVRDYV−−−−LSLAARLPVVEVSRA
fig|573235.3.peg.5081   Escherichia coli O26:H11 str. 11368     MMMPALQKLPFSGLPFSGICGYSFSAAAKSAAGRENPSNSQATYDAP−−RVFFCVAINATERQIMVWCVVSRADGIPCILPASAHYAAESMVAQAGQPPGWPVSCEAGILTPVWAIAIERENSGDSVICYSQEAAIMATTLTPSHPEFVF−−−−−−−VFAAVRRADRHPRICMLRTVA−−−−GDERSARRSLVRDYV−−−−LSLAARLPVVEVSRA
fig|1169328.3.peg.4083   Escherichia coli KTE8     MMMPVLQKLPFSGLPFSGICGYSFSAAAKSAAGRENPSNLTATYDAP−−CVFFCVAINATERQIMVWRVVCRAG−−−MILFAIACYATESMVAQAGQPPGWPVSVRAGILTPVWAIAIERENSGDSVTCYLTEAAIMATTLTPSHPEFVF−−−−−−−VFAAVRRADRHPRICMLRTVA−−−−GDERSARRSLVRDYV−−−−LSLAARLPVVEVSRA
fig|41514.4.peg.3688   Salmonella enterica subsp. arizonae serovar 62:z4,z23:--     MNQSHFHKAPFSGLHLLYVSWYSFAVAAKSATGRENPSNPSAIPDAP−−CVFFCVAINATERQIMVWCADIRAGVTLRLLPVFVHYAVMSMVAQAGQPSGWPVFDGAGILTPVWAIATERENSGDSNYQLSIGGCLMATTLTPSHPEFIF−−−−−−−VFAAVRRTERKPHICMLRTVA−−−−GDEHTARRSLVRDYV−−−−LSLAARLPLAEVSHA
fig|478008.5.peg.304   Escherichia coli O157:H7 str. EC869     MMMPALQKLPFSGLPFSGICGYSFSAAAKSAAGRENPSMLSATYDAP−−CVFFCVAINATERQIMVWRVVCRAG−−−MILFAIACYATESMVAQAGQPPGWPVSDNAGILTPVWAIAIERENSGDSVIYAVIGGCLMATTLTPSHPEFVF−−−−−−−VFAAVRRADRHPRICMLRTVA−−−−GDERSARRSLVRDYV−−−−LSLAARLPVVEVSRA
fig|550676.3.peg.2570   Escherichia coli B185     MMMPVLQKLPFSGLPFSGICGYSFSAAAKSAAGRENPSMLSATYDAP−−CVFFCVAINATERQIMVWRVVCRAG−−−MILFAIACYATESMVAQAGQPPGWPVSDNAGILTPVWAIAIERENSGDSVIYAVIGGCLMATTLTPSHPEFVF−−−−−−−VFAAVRRADRHPRICMLRTVA−−−−GDERSARRSLVRDYV−−−−LSLAARLPVVEVSRA
fig|209261.1.peg.2478   Salmonella enterica subsp. enterica serovar Typhi Ty2                                                                      MVWRVVCRAG−−−MILFAIACYATESMVAQAGQPPGWPVSDNAGILTPVWAIAIERENSGDSVIYAVIGGCLMATTLTPSHPEFVF−−−−−−−VFAAVRRADRHPRICMLRTVA−−−−GDERSARRSLVRDYV−−−−LSLAARLPVVEVSRA
fig|869677.3.peg.3702   Escherichia coli 96.0497     MMMPVLQKLPFSGLPFSGICGYSFSAVAKSAAGRENPSMLSATYDAP−−CVFFCVAINATEHQIMVWRVVCRAG−−−MILFAIACYASESMVAQAGQPPGWPVSDNAGILTPVWAIAIERENSGDSVIYAVIGGCLMATTLTPSHPEFVF−−−−−−−VFAAVRRADRHPRICMLRTVA−−−−GDERSARRSLVRDYV−−−−LSLAARLPVVEVSRA
fig|481805.3.peg.1130   Escherichia coli ATCC 8739     MMMPVLQKLPFSGLPFSGICGYSFSAVAKSAAGRENPSMLSATYDAP−−CVFFCVAINATEHQIMVWRVVCRAG−−−MILFAIACYASESMVAQAGQPPGWPVSDNAGILTPVWAIAIERENSGDSVIYAVIGGCLMATTLTPSHPEFVF−−−−−−−VFAAVRRADRHPRICMLRTVA−−−−GDERSARRSLVRDYV−−−−LSLAARLPVVEVSRA
fig|481805.3.peg.49   Escherichia coli ATCC 8739     MMMPVLQKLPFSGLPFSGICGYSFSAVAKSAAGRENPSMLSATYDAP−−CVFFCVAINATEHQIMVWRVVCRAG−−−MILFAIACYASESMVAQAGQPPGWPVSDNAGILTPVWAIAIERENSGDSVIYAVIGGCLMATTLTPSHPEFVF−−−−−−−VFAAVRRADRHPRICMLRTVA−−−−GDERSARRSLVRDYV−−−−LSLAARLPVVEVSRA