(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00010222

fig|1157001.3.peg.2006   Staphylococcus aureus HI168     VKQPAHYTYG−−DIEIIDFIEQVTA−−QYP−−PQLAFAIGNAIKYLSRAPLKNG−−−−−−HEDLAKAKFYVDRVFDLWE
fig|1169274.3.peg.1446   Staphylococcus aureus M1309     VKQPAHYTYG−−DIEIIDFIEQVTA−−QYP−−PQLAFAIGNAIKYLSRAPLKNG−−−−−−HEDLAKAKFYVDRVFDLWE
fig|931432.3.peg.2265   Staphylococcus aureus subsp. aureus CIG1057     VKQPAHYTYG−−DIEIIDFIEQVTA−−QYP−−PQLAFAIGNAIKYLSRAPLKNG−−−−−−HEDLAKAKFYVDRVFDLWE
fig|359787.11.peg.1095   Staphylococcus aureus subsp. aureus JH1     VKQPAHYTYG−−DIEIIDFIEQVTA−−QYP−−PQLAFAIGNAIKYLSRAPLKNG−−−−−−HEDLAKAKFYVDRVFDLWE
fig|931433.3.peg.2049   Staphylococcus aureus subsp. aureus CIG1114     VKQPAHYTYG−−DIEIIDFIEQVTA−−QYP−−PQLAFAIGNAIKYLSRAPLKNG−−−−−−HEDLAKAKFYVDRVFDLWE
fig|904750.3.peg.1182   Staphylococcus aureus subsp. aureus 21272     VKQPAHYTYG−−DIEIIDFIEQVTA−−QYP−−PQLAFAIGNAIKYLSRAPLKNG−−−−−−HEDLAKAKFYVDRVFDLWE
fig|1155079.3.peg.99   Staphylococcus aureus subsp. aureus DR10     VKQPAHYTYG−−DIEIIDFIEQVTA−−QYP−−PQLAFAIGNAIKYLSRAPLKNG−−−−−−HEDLAKAKFYVDRVFDLWE
fig|455227.3.peg.1966   Staphylococcus aureus D30     VKQPAHYTYG−−DIEIIDFIEQVTA−−QYP−−PQLAFAIGNAIKYLSRAPLKNG−−−−−−HEDLAKAKFYVDRVFDLWE
fig|585145.3.peg.1726   Staphylococcus aureus subsp. aureus 65-1322     IKQPAHYTYG−−DIEIIDFIEQVTA−−QYP−−PQLAFAIGNAIKYLSRAPLKNG−−−−−−HEDLAKAKFYVDRVFDLWE
fig|1158487.3.peg.1505   Staphylococcus aureus M1321     VKQPAHYTYG−−DIEIIDFIEQVTA−−QYP−−PQLAFAIGNAIKYLSRAPLKNG−−−−−−HEDLAKAKFYVDRVLDLWE
fig|1158709.3.peg.1570   Staphylococcus aureus M1015     VKQPAHYTYG−−DIEIIDFIEQVTA−−QYP−−PQLAFAIGNAIKYLSRAPLKNG−−−−−−HEDLAKAKFYVDRVLDLWE
fig|931451.3.peg.2049   Staphylococcus aureus subsp. aureus CIG290     VKQPAHYTYG−−DIEIIDFIEQVTA−−QYP−−PQLAFAIGNAIKYLSRAPLKNG−−−−−−HEDLAKAKFYVDRVLDLWE
fig|931433.3.peg.2558   Staphylococcus aureus subsp. aureus CIG1114     VKQPAHYTYG−−DIEIIDFIEQVTA−−QYP−−PQLAFAIGNAIKYLSRAPLKNG−−−−−−HEDMAKAKFYVDRAFDLWE
fig|505321.3.peg.2021   Staphylococcus aureus subsp. aureus str. CF-Marseille     VKQPAHYTYG−−DIEIIDFIEQVTA−−QYP−−PQLAFAIGNAIKYLSRAPLKNG−−−−−−HEDMAKAKFYVDRVFDLWE
fig|320835.3.peg.6   Bacteriophage 53     VKQPAHYTYG−−DIEIIDFIEQVTA−−QYP−−PQLAFAIGNAIKYLSRAPLKNG−−−−−−HEDMAKAKFYVDRVFDLWE
fig|904780.3.peg.1642   Staphylococcus aureus subsp. aureus IS-99     VKQPAHYTYG−−DIEIIDFIEQVTA−−QYP−−PQLAFAIGNAIKYLSRAPLKNG−−−−−−HEDMAKAKFYVDRVFDLWE
fig|505321.3.peg.284   Staphylococcus aureus subsp. aureus str. CF-Marseille     VKQPAHYTYG−−DIEIIDFIEQVTA−−QYP−−PQLAFAIGNAIKYLSRAPLKNG−−−−−−HEDLAKAKFYAQRAFDLWE
fig|548473.6.peg.1636   Staphylococcus aureus subsp. aureus TCH60     VKQPAHYTYG−−DIEIIDFIEQVTA−−QYP−−PQLAFAIGNAIKYLSRAPLKNG−−−−−−HEDLAKAKFYVQRAFDLWD
fig|585160.3.peg.1005   Staphylococcus aureus subsp. aureus WBG10049     VKQPAHYTYG−−DIEIIDFIEQVTA−−QYP−−PQLAFAIGNAIKYLSRAPLKNG−−−−−−HEDLAKAKFYVQRAFDLWD
fig|273036.3.peg.1677   Staphylococcus aureus RF122     VKQPAHYTYG−−DIEVIDFIEQVTA−−QYP−−PQLAFAIGNAIKCLSRAPLNNG−−−−−−HEDLAKAKFYVQRAFDLWE
fig|273036.6.peg.1841   Staphylococcus aureus RF122     VKQPAHYTYG−−DIEVIDFIEQVTA−−QYP−−PQLAFAIGNAIKCLSRAPLNNG−−−−−−HEDLAKAKFYVQRAFDLWE
fig|904725.3.peg.2281   Staphylococcus aureus subsp. aureus 21189     VKQPAHYTYG−−DIEIIDFIEQVTA−−QYP−−PQLAFAIGNAIKYMSRAPLKNG−−−−−−HEDLAKAKFYVQRAFDLWE
fig|505321.3.peg.1547   Staphylococcus aureus subsp. aureus str. CF-Marseille     VKQPAHYTYG−−DIEIIDFIEQVTA−−QYP−−PQLAFAIGNAIKYLSRAPLKNG−−−−−−HEDLAKAKFYVQRAFDLWE
fig|904750.3.peg.193   Staphylococcus aureus subsp. aureus 21272     VKQPAHYTYG−−DIEIIDFIEQVTA−−QYP−−PQLAFAIGNAIKYLSRAPLKNG−−−−−−HEDLAKAKFYVQRAFDLWE
fig|1158487.3.peg.2017   Staphylococcus aureus M1321     VKQPAHYTYG−−DIEIIDFIEQVTA−−QYP−−PQLAFAIGNAIKYLSRAPLKNG−−−−−−HEDLAKAKFYVQRAFDLWE
fig|1169274.3.peg.1954   Staphylococcus aureus M1309     VKQPAHYTYG−−DIEIIDFIEQVTA−−QYP−−PQLAFAIGNAIKYLSRAPLKNG−−−−−−HEDLAKAKFYVQRAFDLWE
fig|359787.11.peg.2119   Staphylococcus aureus subsp. aureus JH1     VKQPAHYTYG−−DIEIIDFIEQVTA−−QYP−−PQLAFAIGNAIKYLSRAPLKNG−−−−−−HEDLAKAKFYVQRAFDLWE
fig|505321.3.peg.453   Staphylococcus aureus subsp. aureus str. CF-Marseille     VKQPAHYTYG−−DIEIIDFIEQVTA−−QYP−−PQLAFAIGNAIKYLSRAPLKNG−−−−−−HEDLAKAKFYVQRAFDLWE
fig|904780.3.peg.1003   Staphylococcus aureus subsp. aureus IS-99     VKQPAHYTYG−−DIEIIDFIEQVTA−−QYP−−PQLAFAIGNAIKYLSRAPLKNG−−−−−−HEDLAKAKFYVQRAFDLWE
fig|904780.3.peg.1641   Staphylococcus aureus subsp. aureus IS-99     VKQPAHYTYG−−DIEIIDFIEQVTA−−QYP−−PQLAFAIGNAIKYLSRAPLKNG−−−−−−HEDLAKAKFYVQRAFDLWE
fig|904780.3.peg.669   Staphylococcus aureus subsp. aureus IS-99     VKQPAHYTYG−−DIEIIDFIEQVTA−−QYP−−PQLAFAIGNAIKYLSRAPLKNG−−−−−−HEDLAKAKFYVQRAFDLWE
fig|931432.3.peg.1637   Staphylococcus aureus subsp. aureus CIG1057     VKQPAHYTYG−−DIEIIDFIEQVTA−−QYP−−PQLAFAIGNAIKYLSRAPLKNG−−−−−−HEDLAKAKFYVQRAFDLWE
fig|282459.5.peg.949   Staphylococcus aureus subsp. aureus MSSA476     VKQPAHYTYG−−DIEIIDFIEQVTA−−QYP−−PQLAFAIGNAIKYLSRAPLKNG−−−−−−HEDLAKAKFYVQRAFDLWE
fig|585148.3.peg.1049   Staphylococcus aureus subsp. aureus Btn1260     VKQPAHYTYG−−DIEIIDFIEQVTA−−QYP−−PQLAFAIGNAIKYLSRAPLKNG−−−−−−HEDLAKAKFYVQRAFDLWE
fig|931442.3.peg.945   Staphylococcus aureus subsp. aureus CIG547     VKQPAHYTYG−−DIEIIDFIEQVTA−−QYP−−PQLAFAIGNAIKYLSRAPLKNG−−−−−−HEDLAKAKFYVQRAFDLWE
fig|698737.3.peg.2209   Staphylococcus lugdunensis HKU09-01     VNSPSHYNYG−−DIEVIDYIEQVTA−−HYP−−SNLAYDIGNAIKYLSRATHKNG−−−−−−KEDIAKARWYVQRVFEKW 
fig|525375.3.peg.1134   Staphylococcus epidermidis M23864:W2(grey)     VNHPTHYTYG−−NIEIIDFIEQVTK−−DYK−−PELAFAIGNAIKYISRANHKNG−−−−−−KEDLDKARWYLNRAFEKWE
fig|525375.3.peg.1920   Staphylococcus epidermidis M23864:W2(grey)     VNHPSHYTYG−−EIEIMDFIEQVTK−−DYK−−PELAFAIGNAIKYISRANRKNG−−−−−−KEDLDKARWYLNRAFEKWE
fig|525374.3.peg.981   Staphylococcus epidermidis BCM-HMP0060     VNYPSHYTYG−−DIEIIDFIEQVTK−−DYK−−PELAFAIGNAIKYISRANRKNG−−−−−−KEDLDKARWYLNRAFEKWE
fig|525378.3.peg.317   Staphylococcus epidermidis M23864:W1     INQPPHYTYG−−DIEIIDVIEMITK−−EYP−−SELAFVIGNATKYISRSPYKNG−−−−−−VEDLKKARWYIDRAIEKWS
fig|458233.11.peg.1027   Macrococcus caseolyticus JCSC5402     INKAGHYNYG−−DIEVIDFIEQVIE−−HYP−−SVVANSIANVIKYVARAPHKND−−−−−−VQDLEKAQYYIKRAIDK  
fig|314275.3.peg.2836   Alteromonas macleodii 'Deep ecotype'     VNNPKHYDLFPDQQAIDVIRAALTPE−−−−−EFAGYCKGNALKYRLRAGNKDK−−−−−−LQQDIDKSEWYRNKLFE   
fig|314275.5.peg.816   Alteromonas macleodii 'Deep ecotype'     VNNPKHYDLFPDQQAIDVIRAALTPE−−−−−EFAGYCKGNALKYRLRAGNKDK−−−−−−LQQDIDKSEWYRNKLFE   
fig|195099.5.peg.551   Campylobacter jejuni RM1221     VNNPPHYKGF−−GFENLDFLEEIFN−−IMPEKRIVFHIGNALKYAIRSKFKGYE−−−−−−MQDLEKCEFYVKR      
fig|525268.3.peg.1250   Corynebacterium striatum ATCC 6940     VNHPPHYTGFSNGAEVIDITEN−−−−−−−−−−−−LTFNTGNACKYAARAGRTDGRNKGAVIEDLNKAIWYLRRELE   
fig|439375.7.peg.248   Ochrobactrum anthropi ATCC 49188     VNRPAHYTGHPSGIECIQITEH−−−−−−−−−−−−MGFNLGNAVKYIWRCDLKQDA−−−−−−IEDLEKARWYIDREIKK  
fig|247156.1.peg.3892   Nocardia farcinica IFM 10152     VNHPAHYTQSRFTCECIDITRH−−−−−−−−−−−−MTFLAGNASKYIWRFAEKNG−−−−−−VEDLRKAAVYLRWAIE   
fig|205913.11.peg.738   Bifidobacterium longum DJO10A (Prj:321)     VNSPKHYTDSHPGMECIDLTAD−−−−−−−−−−−−TTFCLGNCCKYLWRYHSKGRP−−−−−−LEDLEKARWYLCRVID   
fig|411481.5.peg.207   Bifidobacterium adolescentis L2-32       NPSHYKDG−−PFECIELSRL−−−−−−−−−−−−LSSDWGQAVQYCFRWQHKNG−−−−−−VEDLKKALWFINDAI    
fig|1095700.3.peg.1178   Neisseria meningitidis 87255        PPHYRSR−−AVECIEFTER−−−−−−−−−−−−LNFCMGNAFKYVWRHREKNG−−−−−−AEDLKKARWYLQRQLD   
fig|641149.3.peg.1972   Neisseria sp. oral taxon 014 str. F0314       NPSHYRSR−−AVECIEFTER−−−−−−−−−−−−LNFCMGNAFKYVWRHREKNG−−−−−−AEDLKKAQWYLQRQLD   
fig|528355.5.peg.1597   Neisseria gonorrhoeae PID1       NPGYYKNR−−EHECVGFAQY−−−−−−−−−−−−LNFNLGNAFKYIWRHKEKGG−−−−−−REDLEKALRYLER      
fig|528357.5.peg.823   Neisseria gonorrhoeae PID24-1       NPGYYKNR−−EHECVGFAQY−−−−−−−−−−−−LNFNLGNAFKYIWRHKEKGG−−−−−−REDLEKALRYLER      
fig|528348.4.peg.764   Neisseria gonorrhoeae DGI2       NPGYYKNR−−EHECVGFAQY−−−−−−−−−−−−LNFNLGNAFKYIWRHKEKGG−−−−−−REDLEKALRYLER      
fig|528351.3.peg.974   Neisseria gonorrhoeae F62       NPGYYKNR−−AFECVGFAQY−−−−−−−−−−−−LNFNLGNAFKYIWRHKEKGG−−−−−−REDLEKALRYLER      
fig|528352.5.peg.624   Neisseria gonorrhoeae FA19       NPGYYKNR−−AFECVGFAQY−−−−−−−−−−−−LNFNLGNAFKYIWRHKEKGG−−−−−−REDLEKALRYLER      
fig|528352.5.peg.1417   Neisseria gonorrhoeae FA19       NPGYYKNR−−AFECVGFAQY−−−−−−−−−−−−LNFNLGNAFKYIWRHKEKGG−−−−−−REDLEKALRYLER      
fig|528345.7.peg.1512   Neisseria gonorrhoeae 1291       NPGYYKNR−−AFECVGFAQY−−−−−−−−−−−−LNFNLGNAFKYIWRHKEKGG−−−−−−REDLEKALRYLER      
fig|528351.3.peg.975   Neisseria gonorrhoeae F62       NPGYYKNR−−AFECVGFAQY−−−−−−−−−−−−LNFNLGNAFKYIWRHKEKGG−−−−−−REDLEKALRYLER      
fig|528357.5.peg.666   Neisseria gonorrhoeae PID24-1       NPGYYKNR−−AFECVGFAQY−−−−−−−−−−−−LNFNLGNAFKYIWRHKEKGG−−−−−−REDLEKALRYLER      
fig|940296.3.peg.1412   Neisseria gonorrhoeae TCDC-NG08107       NPGYYKNR−−AFECVGFAQY−−−−−−−−−−−−LNFNLGNAFKYIWRHKEKGG−−−−−−REDLEKALRYLER      
fig|940296.3.peg.1915   Neisseria gonorrhoeae TCDC-NG08107       NPGYYKNR−−AFECVGFAQY−−−−−−−−−−−−LNFNLGNAFKYIWRHKEKGG−−−−−−REDLEKALRYLER      
fig|940296.3.peg.653   Neisseria gonorrhoeae TCDC-NG08107       NPGYYKNR−−AFECVGFAQY−−−−−−−−−−−−LNFNLGNAFKYIWRHKEKGG−−−−−−REDLEKALRYLER      
fig|528355.5.peg.866   Neisseria gonorrhoeae PID1       NPGYYKNR−−AFECVGFAQY−−−−−−−−−−−−LNFNLGNAFKYIWRHKEKGG−−−−−−REDLEKALRYLER      
fig|546273.3.peg.1117   Veillonella dispar ATCC 17748     INHPSHYTRG−−KIEVIDFIED−−−−−−−−−−QQLPYHLGNVIKYIARAGYKGDK−−−−−−LEDLKKARWYLDRYIN   
fig|653938.3.peg.697   Listeria monocytogenes 08-5578     ISQPSHYTSG−−GIEPIKFIQS−−−−−−−−−−HNMNFEKGNVIKYVTRAGKKEGQNE−−−VKDLKKARQYLDFLIGKLE
fig|66692.3.peg.1441   Bacillus clausii KSM-K16       RPSHYKS−−−KIDPLAYMKENMSAA−−−−−GYEGFLIGNVIKYVTRYPKKNG−−−−−−LEDLKKAKDYLNKAIELY 
fig|66692.6.peg.1457   Bacillus clausii KSM-K16                        MKENMSAA−−−−−GYEGFLIGNVIKYVTRYPKKNG−−−−−−LEDLKKAKDYLNKAIELY 
fig|398578.5.peg.3264   Delftia acidovorans SPH-1          HYKGC−−AIQPIQYIHA−−−−−−−−−−NGLDFFQGNIVKYATRYKAKNG−−−−−−AEDLKKVIHYAQLALEL  
fig|495036.3.peg.2033   Geobacillus sp. G11MC16       RPDYYKVG−−GIEPIDYMKAKMTPE−−−−−QFEGFCLGNVYKYTGRYLYKGG−−−−−−LTDLKKARYYLERLIE   
fig|653938.3.peg.1360   Listeria monocytogenes 08-5578     VNNPSHYTAG−−GIETLDYIKAKVK−−−−−−−DYPSYAVGNILKYVSRYEHKNG−−−−−−IEDLKKAQFYLNDLIE   
fig|393121.7.peg.2826   Listeria monocytogenes FSL J2-071     VNNPSHYTAG−−GIETLDYIKAKVK−−−−−−−DYPSYAVGNILKYVSRYEHKNG−−−−−−IEDLKKAQFYLNDLIE   
fig|393121.3.peg.3168   Listeria monocytogenes FSL J2-071     VNNPSHYTAG−−GIETLDYIKAKVK−−−−−−−DYPSYAVGNILKYVSRYEHKNG−−−−−−IEDLKKAQFYLNDLIE   
fig|401650.12.peg.2743   Listeria monocytogenes HPB2262     INNPSHYTAG−−GIETLDYIKAKVS−−−−−−−DYPSYAVGNIFKYVSRYEHKNG−−−−−−IEDLKKAQFYLNDLIERME
fig|272626.9.peg.2652   Listeria innocua Clip11262     VNNPAHYTAG−−GIETLDYIKAKVN−−−−−−−DYPSYAVGNILKYVSRYEHKNG−−−−−−IEDLKKAQFYLNNLIE   
fig|393126.4.peg.989   Listeria monocytogenes FSL R2-561     VNNPAHYTSG−−GIETLDYIKAKVS−−−−−−−DYPSYAVGNILKYVSRYEHKNG−−−−−−IEDLKKARFYLNDLI    
fig|552536.6.peg.1366   Listeria monocytogenes HCC23     VNNPAHYTAG−−GIETLDYIKAKVS−−−−−−−DYPSYAVGNILKYVSRYEHKNG−−−−−−IEDLKKAQFYLNDLIE   
fig|245018.3.peg.1774   butyrate-producing bacterium SSC/2     VNHPNHYQSETGLEVIDVIDAFTD−−GLD−−GVEAFDTGNIIKYICRWKKKNG−−−−−−IEDLEKAKWYLENLI    
fig|665950.3.peg.2003   Lachnospiraceae bacterium 3_1_46FAA     VSHPEHYMSKTGMEVIDVIEAFTD−−ELK−−GVEATDTGNIIKYACRWKKKNG−−−−−−IQDLEKILWYTQHLID   
fig|585506.3.peg.1758   Weissella paramesenteroides ATCC 33313     IDKPEHYVLSDGTEVKDHINSIVA−−GMN−−GSEAWKVANIIKYVSRADKKNG−−−−−−KEDLKKARKYIDLLID   
fig|393480.8.peg.1297   Fusobacterium nucleatum subsp. polymorphum ATCC 10953     VNQPNHYQIGNTGLECKDFISAWV−−−GKG−−NYGVFCFCNIMKYLVRAEKKNK−−−−−−LEDYKKALKYLDMIIE   
fig|469621.8.peg.1899   Fusobacterium periodonticum 1_1_41FAA     VNQPNHYVIGDTGLECKDFISAWV−−−GKG−−YYSVFCFCNVMKYLVRAEKKNK−−−−−−LEDYKKALKYLDMIIE   
fig|469599.3.peg.2150   Fusobacterium sp. 2_1_31     VHSPKHYMIPGCNFECKDLSDAIVR−−NMP−−NPLGTRIWNVVKYLVRAEKKNG−−−−−−LEDYNKAVEYLSWIEK   
fig|469599.8.peg.1005   Fusobacterium periodonticum 2_1_31     VHSPKHYMIPGCNFECKDLSDAIVR−−NMP−−NPLGTRIWNVVKYLVRAEKKNG−−−−−−LEDYNKAVEYLSWIEK   
fig|469604.3.peg.393   Fusobacterium sp. 3_1_36A2     VNNPNHYKLGCGVESIEIIKRVL−−−GLK−−GFVAFCLGNILKYLIRAEKKNK−−−−−−LEDYKKAAKYLEWVIQNY 
fig|556264.8.peg.1420   Fusobacterium nucleatum subsp. animalis D11     INNPNHYKLSCGVESIEIIKRVL−−−GLK−−GFVAFCLGNILKYLIRAEKKNG−−−−−−KEDYKKAAKYLEWVIE   
fig|546275.3.peg.1734   Fusobacterium periodonticum ATCC 33693     VKSPKHYMLGDLGIEVKDVIFEVVK−−DMK−−GSEAVCVGNILKYVMRARKKNG−−−−−−IEDYKKAYEYLGYLLE   
fig|469605.7.peg.70   Fusobacterium gonidiaformans 3-1-5R     VKNPKHYQLGNLGIEAIDVIREVTG−−ELKDGFQGKCVGDILKYVMRAHKKNG−−−−−−IQDYEKAQEYLTYLI    
fig|596319.3.peg.2219   Staphylococcus warneri L37603     VKQPPHYQFG−−IFTANVIIEAVGK−−TYKSASVFYHVGNALKYLMRASRKNG−−−−−−LEDLKKARESVDMAIQVWD
fig|525376.3.peg.1151   Staphylococcus epidermidis W23144     VNQPKHYQFG−−KFNAHTIIETVAK−−TYTSTAVFYHVGNALKYLLRAPRKNG−−−−−−LEDLKKAKKSIDFAINCWK
fig|638301.3.peg.1747   Granulicatella adiacens ATCC 49175     VKHPKHYQGINGLEVFTVMENFIP−−KYENSFDGYIAGNVLKYVLRAPSKGK−−−−−−MLEDLKKAKEHLDLLIERLE
fig|469618.3.peg.1779   Fusobacterium varium ATCC 27725         SHYEFGNGLNCMDFIIEAVK−−DSK−−GIEAFYQANAIKYLFRANKKNG−−−−−−IDDLKKAHNYI        
fig|445975.6.peg.1582   Collinsella stercoris DSM 13279     VEHPDHYAGDGEIECMDAMRSMMSGDSYALPAIAAHWWAEAFKYIWRWRRKGG−−−−−−VQDLRKCRQCIDYLI    
fig|365659.3.peg.435   Streptococcus mitis B6     INKPNHYIGTYGLEVKDVTRNFIK−−GKS−−EMEAHRWCSAVEYLLRYKEKNG−−−−−−IEDLKKARKNLDWLIEEME
fig|497980.3.peg.1527   Streptococcus pneumoniae 459-5     INKPSHYQGANGLEAIDVVHNFVG−−SLS−−GASAFFWGNAIKYMLRFQKKNG−−−−−−LEDLKKARKNLDWLIE   
fig|1159095.3.peg.1584   Streptococcus pneumoniae PNI0159     INKPSHYQGANGLEAIDVVHNFVG−−SLS−−GASAFFWGNAIKYMLRFQKKNG−−−−−−LEDLKKARKNLDWLIEEME
fig|512767.4.peg.282   Streptococcus pneumoniae BS397     INKPSHYQGANGLEAIDVVHNFVG−−NLF−−GASAFFWGNAIKYMLRFQKKNG−−−−−−LEDLKKARKNLDWLIEEME
fig|406560.5.peg.2575   Streptococcus pneumoniae SP14-BS69     INKPSHYQGANGLEAIDVVHNFVG−−NLS−−GASAFFWGNAIKYMLRFQKKNG−−−−−−LEDLKKARKNLDWLIE   
fig|286604.5.peg.1001   Streptococcus suis 89/1591     VTKPKHYQGKHGMEALDVVKNFIW−−DLA−−GERAYYWGNVIKYLLRFQQKNG−−−−−−VEDLKKARQHLDWLIE   
fig|1105241.3.peg.2001   Streptococcus agalactiae str. Gottschalk 998A     VNYPSHYQGKYGLESIDVLRNFM−−−TPE−−MLKGFYLGNALKYQLRYRKKNG−−−−−−LEDLKKARKNLDWLIEEME
fig|208435.3.peg.1872   Streptococcus agalactiae 2603V/R     VNYPSHYQGKYGLESIDVLRNFM−−−TPE−−MLKGFYLGNALKYQLRYRKKNG−−−−−−LEDLKKARKNLDWLIEEME
fig|208435.1.peg.1819   Streptococcus agalactiae 2603V/R     VNYPSHYQGKYGLESIDVLRNFM−−−TPE−−MLKGFYLGNALKYQLRYRKKNG−−−−−−LEDLKKARKNLDWLIEEME
fig|148942.4.peg.129   Streptococcus equi subsp. equi     IKKPSHYQGRHGMEAIDVVKNFAA−−CPE−−HEEGFYWGNAVKYLLRYHAKNG−−−−−−VEDLKKARQNLDWLIEKLE
fig|553482.3.peg.147   Streptococcus equi subsp. equi 4047     IKKPSHYQGRHGMEAIDVVKNFAA−−CPE−−HEEGFYWGNAVKYLLRYHAKNG−−−−−−VEDLKKARQNLDWLIEKLE
fig|193567.3.peg.673   Streptococcus pyogenes SSI-1     IKKPSHYQGRHGMEAIDVVKNFGA−−CPE−−YEEGFYWGNAVKYLLRYHAKNG−−−−−−VEDLKKARQNLDWLIEKLE
fig|319701.3.peg.1644   Streptococcus pyogenes MGAS6180     IKKPSHYQGRHGMEAIDVVKNFGA−−CPE−−YEEGFYWGNAVKYLLRYHAKNG−−−−−−VEDLKKARQNLDWLIEKLE
fig|370552.4.peg.1363   Streptococcus pyogenes MGAS10270     IKKPSHYQGRHGMEAIDVVKNFGA−−CPE−−YEEGFYWGNAVKYLLRYHAKNG−−−−−−VEDLKKARQNLDWLIEKLE
fig|370552.4.peg.829   Streptococcus pyogenes MGAS10270     IKKPSHYQGRHGMEAIDVVKNFSA−−CPE−−HEEGFYWGNAVKYLLRYHAKNG−−−−−−VEDLKKARQNLDWLIEKLE
fig|186103.1.peg.571   Streptococcus pyogenes MGAS8232     IKKPSHYQGRHGMEAIDVVKNFSA−−CPE−−HEEGFYWGNAVKYLLRYHAKNG−−−−−−VEDLKKARQNLDWLIKKLE
fig|186103.1.peg.1477   Streptococcus pyogenes MGAS8232     IKKPSHYQGRHGMEAIDVVKNFSA−−CPE−−HEEGFYWGNAVKYLLRYHAKNG−−−−−−IEDLKKARQNLDWLIEKLE
fig|193567.3.peg.573   Streptococcus pyogenes SSI-1     IKKPSHYQGRHGMEAIDVVKNFSA−−CPE−−HEEGFYWGNAVKYLLRYHAKNG−−−−−−IEDLKKARQNLDWLIEKLE