(in new window)

SEED user:
Focus protein ID:
 

Use for functions:    
Of identical sequences, show:    

Color alignment by:      
Alignment format:      

Tree format:      


Alignment 00009961

fig|344610.7.peg.4764   Escherichia coli 53638           FNDKV−−−−−SMT−−−−−−−−SVEIAELVGSQHGNVRISIE−−−−−−−RLAKRGVIQLPAMQKVENEQSFSQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NKF−−−−−TNAYIFEGEQGKRDSIIVVAQLCP−−−−−−EFTARLVDRWRELEE−−−−−−−−−QVRKPMSEIE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MVAAMALEAVRQQKRLDKMEEKV                                                                                                                                 
fig|344610.3.peg.5003   Escherichia coli 53638           FNDKV−−−−−SMT−−−−−−−−SVEIAELVGSQHGNVRISIE−−−−−−−RLAKRGVIQLPAMQKVENEQSFSQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NKF−−−−−TNAYIFEGEQGKRDSIIVVAQLCP−−−−−−EFTARLVDRWRELEE−−−−−−−−−QVRKPMSEIE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MVAAMALEAVRQQKRLDKMEEKV                                                                                                                                 
fig|358708.5.peg.3885   Shigella dysenteriae 1012           FNDKV−−−−−SMT−−−−−−−−SVEIAELVGSQHGNVRISIE−−−−−−−RLAKRGVIQLPAMQKVENEQSFSQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NKF−−−−−TNAYIFEGEQGKRDSIIVVAQLCP−−−−−−EFTARLVDRWRELEE−−−−−−−−−QVRKPMSEIE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MVAAMALEAVRQQKRITQVEEKV                                                                                                                                 
fig|766138.3.peg.1407   Shigella boydii 965-58           FNDKV−−−−−SMT−−−−−−−−SVEIAELVGSQHGNVRISIE−−−−−−−RLAKRGVIQLPAMQKVENEQSFSQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NKF−−−−−TNAYIFEGEQGKRDSIIVVAQLCP−−−−−−EFTARLVDRWRELEE−−−−−−−−−QVRKPMSEIE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MVAAMALEAVRQQKRITQVEEKV                                                                                                                                 
fig|344609.3.peg.3043   Shigella boydii BS512           FNGKA−−−−−SMT−−−−−−−−SVEIAELVGSRPDSVKRTIE−−−−−−−TLAKKGIIQFPQTVEIENKQSLGP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RRF−−−−−SSAYVFEGERGKRDSIIVVAQLCP−−−−−−EFTARLVDRWRELEE−−−−−−−−−QIRKPMSEIE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MVAAMALEAVRQQKRITQVEEKV                                                                                                                                 
fig|670892.3.peg.4029   Escherichia coli 3431           FNGKA−−−−−SMT−−−−−−−−SVEIAELVGSRPDSVKRTIE−−−−−−−TLAKKGIIQFPQTVEIENKQSLGP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RRF−−−−−SSAYVFEGERGKRDSIIVVAQLCP−−−−−−EFTARLVDRWRELEE−−−−−−−−−QIRKPMSEIE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MVAAMALEAVRQQKRITQVEEKV                                                                                                                                 
fig|868194.3.peg.2828   Escherichia coli DEC12D           FNGKA−−−−−SMT−−−−−−−−SVEIAELVGSRPDSVKRTIE−−−−−−−TLAKKGIIQFPQTVEIENKQSLGP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RRF−−−−−SSAYVFEGERGKRDSIIVVAQLCP−−−−−−EFTARLVDRWRELEE−−−−−−−−−QIRKPMSEIE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MVAAMALEAVRQQKRITQVEEKV                                                                                                                                 
fig|409438.11.peg.2243   Escherichia coli SE11           FNDKA−−−−−SMT−−−−−−−−SVEIAELVGSQHSDVKRSIE−−−−−−−RLVAKNIIRKPPMAVSEKINNLGF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KVQ−−−−−YEHYLFEGEQGKRDSIIVVAQLCP−−−−−−EFTARLVDRWRELEE−−−−−−−−−QIRKPMSEIE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MVAAMALEAVRQQKRITQVEEKV                                                                                                                                 
fig|1078033.4.peg.2975   Escherichia coli O45:H2 str. 03-EN-705           FNGKA−−−−−SMT−−−−−−−−SVEIAELVGSQHSDVKRSIE−−−−−−−RLVAKNIIRKPPMAVSEKINNLGF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KVQ−−−−−YEHYLFEGEQGKRDSIIVVAQLCP−−−−−−EFTARLVDRWRELEE−−−−−−−−−QIRKPMSEIE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MVAAMALEAVRQQKRITQVEEKV                                                                                                                                 
fig|585395.4.peg.2209   Escherichia coli O103:H2 str. 12009           FNGKA−−−−−SMT−−−−−−−−SVEIAELVGSQHSDVKRSIE−−−−−−−RLVAKNIIRKPPMAVSEKINNLGF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KVQ−−−−−YEHYLFEGEQGKRDSIIVVAQLCP−−−−−−EFTARLVDRWRELEE−−−−−−−−−QIRKPMSEIE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MVAAMALEAVRQQKRITQVEEKV                                                                                                                                 
fig|344610.3.peg.4976   Escherichia coli 53638           FNDKV−−−−−SMT−−−−−−−−SVEIAELVGKRHDNVKRTIE−−−−−−−TLAKGGVVRSPQIEVSERINNLGF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KVQ−−−−−YEHYLFEGEQGKRDSIIVVAQLCP−−−−−−EFTARLVDRWRELEE−−−−−−−−−QIRKPMSEIE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MVAAMALEAVRQQKRLDKMEEKV                                                                                                                                 
fig|344610.7.peg.4324   Escherichia coli 53638           FNDKV−−−−−SMT−−−−−−−−SVEIAELVGKRHDNVKRTIE−−−−−−−TLAKGGVVRSPQIEVSERINNLGF−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KVQ−−−−−YEHYLFEGEQGKRDSIIVVAQLCP−−−−−−EFTARLVDRWRELEE−−−−−−−−−QIRKPMSEIE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MVAAMALEAVRQQKRLDKMEEKV                                                                                                                                 
fig|683082.3.peg.536   Campylobacter jejuni subsp. jejuni 1336          DENKEI−−−−−SLT−−−−−−−−SLEIAELTGKEHFNVIRDIE−−−−−−−TYL−−−−−−−−−EKVVEGGVFKFE−−−−−−−−−−−−−−−−−−−−−−−−−−DTYQN−−−−−PQ−−−−−−−−−N−−−KQF−−−−−YKCYRLP−−−−KREVLILVSGYSV−−−−−−ELRAKIIDRLEYLEN−−−−−−−−−ELKKQS−−−−−−−−−−−−−−−YKPLSLKESLQM−−−−−−−−−−−−−−−−−−QLELLE−−−−−−RNEKLQIENV−−−−−−−−−−−−NLKNEAKENAPL                                                                                                          
fig|1111073.3.peg.598   Campylobacter jejuni subsp. jejuni RB922          DENKEI−−−−−SLT−−−−−−−−SLEIAELTGKEHFHVIRDIE−−−−−−−TYL−−−−−−−−−EKVVEGGISKFG−−−−−−−−−−−−−−−−−−−−−−−−−−DTYQN−−−−−TQ−−−−−−−−−N−−−KQS−−−−−YKYYRLP−−−−KREVLILVSGYSV−−−−−−ELRAKIIDRLEYLEN−−−−−−−−−ELKKQS−−−−−−−−−−−−−−−YKPLSLKESLQM−−−−−−−−−−−−−−−−−−QLELLE−−−−−−KNEKLQVENQ−−−−−−−−−−−−SLKNEAEQNAPL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IHFANRIQNTNDAILIRDYAKILHEKNNLEIGEKR                     
fig|1316932.3.peg.1650   Mannheimia haemolytica M42548     SLLPITAQNASGAEVKIS−−−−−−−−SIEIAELCEKQHKNVIVDIR−−−−−−−KML−−−−−−−−−AELKLNSADFSA−−−−−−−−−−−−−−−−−−−−−−−−−−−QYQT−−−−−KD−−−−−−−−−−−−−GRM−−−−−QPCYFLP−−−−KRETMILVSGYRI−−−−−−DLRAKIIDRLDELEK−−−−−−−−−Q−−−−−−−−−−−−−−−−−HQPSIPKNYPEALRM−−−−−−−−−−−−−−−−−−AAELAEQNQVLLLEKQQTTAENHALKSYFEPGLTPAQFVKGLNGVNSNKINDYLRSR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GWLYKDKHCWR                            
fig|669261.3.peg.2451   Mannheimia haemolytica serotype A2 str. OVINE          EQKSSI−−−−−TMS−−−−−−−−SREIAELCEKEHRHVLRDIR−−−−−−−AYVGAIIQME−−RGINVKSLDWSGKEGVELF−−−GHTPIGGVICRY−−−−−EVNP−−−−−QN−−−−−−−−−−−−−NQS−−−−−YPIYYLD−−−−KSATLTIISGYNI−−−−−−LLRKKIIDRWQELET−−−−−−−−−QVPQSS−−−−−−−−−−−−KTPHIPQTYAEALRL−−−−−−−−−−−−−−−−−−AADQAEQNQLLQLENKQKTEENNALKSYFEPGLTPAQFVKGLNGVNSNKINDYLRTR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GWLYKEKHCWR                            
fig|537457.7.peg.487   Actinobacillus pleuropneumoniae serovar 7 str. AP76                   ITMS−−−−−−−−SREIAVLIQKNHSDLCRSIG−−−−−−−RLI−−−−−−−−−EKQVIKGYQPTA−−−−−−−−−−−−−−−−−−−−−−−−−−−YTHP−−−−−QN−−−−−−−−−−−−−GQS−−−−−YYEYHLA−−−−KRDCLIVVAQNCP−−−−−−EFTAAIVDRWQELEN−−−−−−−−−Q−−−−−−−−−−−−−−−−−QAVKLPQSFAEALRL−−−−−−−−−−−−−−−−−−AADLEEEKQALLLENQQQLAQIESMESYFRNGISAPQFAKGLNGVNSHQINEHLHQV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RWLYKDAKNQWRVSSY                        
fig|283166.1.peg.642   Bartonella henselae str. Houston-1         FQNTTVQ−−−−−TMS−−−−−−−−SREIAELCGKRHDHVMRDIK−−−−−−−KMLEELNAPKFGVVDFS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GYYLD−−−−−SK−−−−−−−−−−−−−GES−−−−−RPCYNLP−−−−KRECLILVSGYST−−−−−−ALRAKIIDRWQELEK−−−−−−−−−QAITPQI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DYSSPKAMIGFLNYLQGQIDQKDTIIEDLTPKAMALESLQ                                                                                                                
fig|382640.5.peg.462   Bartonella tribocorum CIP 105476         FQNTTVQ−−−−−TMS−−−−−−−−SIEIAQLCEKRHDNVMRDIK−−−−−−−KILEELNVLKFEGVDFS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−GYYLD−−−−−GK−−−−−−−−−−−−−GES−−−−−RPCYNLP−−−−KRECLILVSGYST−−−−−−ALRAKIIDRWQELEK−−−−−−−−−QVVTPQI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DYSSPKAMIGFLNYLQGQIDQKDTIIEDLTPKAMALESLQ                                                                                                                
fig|634504.3.peg.963   Bartonella grahamii as4aup                                SREIAELCGKQHAHIMRDIR−−−−−−−QMLGELYPEGGQSKFG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−STYLD−−−−−KQ−−−−−−−−−−−−−GKP−−−−−QNCYNLP−−−−KRECLILVSGYSM−−−−−−TLRARIIDRWQELEK−−−−−−−−−QAVTPQI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DYSSPKAMIGFLNYLQGQIDQKDTIIEDLTPKAMALESLQ                                                                                                                
fig|634504.3.peg.400   Bartonella grahamii as4aup                                SREIAELCGKQHAHIMRDIR−−−−−−−QMLGELYPEGGQSKFG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−STYLD−−−−−KQ−−−−−−−−−−−−−GKT−−−−−QNCYNLP−−−−KRECLILVSGYSM−−−−−−TLRARIIDRWQELEK−−−−−−−−−QAVTPQI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−DYSSPKAMIGFLNYLQGQIDQKDTIIEDLTPKAMALESLQ                                                                                                                
fig|588581.3.peg.930   Clostridium papyrosolvens DSM 2782                       T−−−−−−−−SMEIAEVTGKQHPHVMRDIR−−−−−−−DEI−−−−−−−−−EKLVSGGIEYQSKFGLVE−−−−−−−−−−−−−−−−−−−−−−YKD−−−−−AK−−−−−−−−−−−−−GEK−−−−−RPYYILT−−−−KEGVLQLAARYDA−−−−−−VVRAKLIELAMKHEP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KPQSIEDLIIMQAQSMKDLKSQ−−−VNTLQLTTQTIKDTVISTPDKWRDDINRMLNKIVKA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VGNSKYRELKTESYKLLEERAHVDLNRRLNNQRYR               
fig|279010.12.peg.1430   Bacillus licheniformis ATCC 14580            NSEI−−−−−KMT−−−−−−−−SLDLAELTGKEHKHIMRDIR−−−−−−−EEINKLGKE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LGESIFGLSSYKT−−−−−LQ−−−−−−−−−−−−−NKE−−−−−LPCYTFG−−−−RKGAMQLALKYDA−−−−−−TTRFKVIERIEQLEK−−−−−−−−−QQQPKTPLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VLQGTINQLVEQDKRMNQLEGQ−−−−−−−−−−VNNISNIVSMNNVGWREKVNVILKRIAKNWTG                                                                                        
fig|526218.6.peg.838   Sebaldella termitidis ATCC 33386             NKE−−−−−TIT−−−−−−−−SLEVAELTNKEHKNILADIR−−−−−−−DEVSKLGED−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−RSRLIFQPIEYLD−−−−−NR−−−−−−−−−−−−−NRK−−−−−QPAFNIT−−−−LDGVLQLGARYDA−−−−−−IIRFNLIQKVNELQN−−−−−−−−−KIKAPV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TMKEALLLALEQQEKIEALELKVIEDMP                                                                                                                            
fig|758678.3.peg.2509   Clostridium botulinum F str. 230613     EIKAVEINGQR−−−VLT−−−−−−−−TEQLAEVYGVEPIRIQQGFI−−−−−−−−−−−−−−−−−−−RNK−−−−−−−EKFQKGKHY−−−FRLI−−−−GEELKEFKANYLKDS−−−SL−−−−−−−−−−−−−KYA−−−−−SELMLWT−−−−ERGANRHCKILDT−−DKAWEQFDNLEETYFRVKE−−−NKVEVNQLSPELQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MFNNLFKALATTELEQKKLNVA−−−VQETKEEVQ                                                                                                                      
fig|445336.4.peg.2961   Clostridium botulinum Bf     EIKPVEVNGER−−−VLT−−−−−−−−TEQLGEVYKVDPIRIQQGFN−−−−−−−−−−−−−−−−−−−RNQ−−−−−−−DKFKESKHY−−−FKLE−−−−GSELKNFKTTYLKDNP−−SM−−−−−−−−−−−−−LRI−−−−−NCLYLWT−−−−ERGANRHCKILDT−−DKAWEQFDNLEETYFRVKE−−−NKVEVNKLSPELQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MFNNLFKALATTELEQKKLNAA−−−VQETKEEV                                                                                                                       
fig|441770.4.peg.2803   Clostridium botulinum A str. ATCC 19397     EIQPVEVEGQR−−−VLT−−−−−−−−TEQLGEVYEVDSIRIQQGFN−−−−−−−−−−−−−−−−−−−RNQ−−−−−−−DKFTEGKHY−−−FKLE−−−−GAELKDFKTNYLKDNP−−SM−−−−−−−−−−−−−LRI−−−−−NCLYLWT−−−−ERGANRHCKILDT−−DKAWEQFDNLEETYFRVRE−−−−−NKLPPMTIEDI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IITQLEEQKKIKKQLTGITNK−−−−−−−−−−−−−−FEELPLFTVDSKE−−−−LSKTVNRI−−−−−−−−−−−−−−−−−−−−−−−AVKFLGGKY−−−−−−SPAYKELSRKVFSDIYRQLWREFDVTSCAAIKRKDLEEAKKIISEYK     
fig|441770.4.peg.2304   Clostridium botulinum A str. ATCC 19397     EIKPIEVKGKR−−−ILT−−−−−−−−TKQLAEVYQCNETQIQQNFN−−−−−−−−−−−−−−−−−−−NHL−−−−−−−DKFILNKHY−−−FLLK−−−−GEELREFKHNIDNIE−−−VA−−−−−−−−−−−−−PNV−−−−−NKLYLWT−−−−ERGANRHCKILDT−−DKAWEQFDNLEETYFRVKE−−−−INPYKGLSKEVQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AIFAIDKKTQEIENKLTGITDK−−−−−−−−−−−−−−FEELPLFTVDSKE−−−−LSKVANRV−−−−−−−−−−−−−−−−−−−−−−−VVKFLGGKG−−−−−−TPAYKELKRKVYSDLYRQLWREFDVTSCAAIKRKDLEEAKKIISEYK     
fig|515621.3.peg.1591   Clostridium botulinum Ba4 str. 657     EIKPVEIGGKR−−−VLT−−−−−−−−TEQLAEIYQTDINNIQVNFK−−−−−−−−−−−−−−−−−−−NHK−−−−−−−GKFTEGKHF−−−YLLQ−−−−GEKLKEFKNHLNNIQL−−VG−−−−−−−−−−−−−KRA−−−−−SSLYLWT−−−−ERGANRHCKILDT−−DKAWEQFDNLEETYFRVKE−−−−INPYKGLSKEVQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AIFAIDKKTQEIEKKLTGITDK−−−−−−−−−−−−−−FEELPLFTVDSKE−−−−LSKVANRV−−−−−−−−−−−−−−−−−−−−−−−VVKFLGGKG−−−−−−TPAYKELKRKVYSDLYRQLWREFDVTSCAAIKRKDLEEAKKIISEYK     
fig|536227.4.peg.2956   Clostridium carboxidivorans P7     ELVPIEFKNKR−−−ILT−−−−−−−−TEQLAEIYEAPIDNIKVNFN−−−−−−−−−−−−−−−−−−−NHK−−−−−−−NNFEEGKHY−−−FYLE−−−−GDDLKEFKRHVNNIYPPLIN−−−−−−−−−−−−−KFT−−−−−SSLYLWT−−−−ERGANRHCKILDT−−DKAWEQFDNLEENYFNVKE−−−−−−−GNQLSPMEILDL−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QYQALRE−−−−QGKKINSIEGR−−−VE−−−−−−−TLSLTMNISAGQAQT−−−−IQKLVHKR−−−−−−−−−−−−−−−−−−−−−−−VKTLCYGDE−−−−SNAYNNQKLRKKVYQYIWKTLKDYLNVTVYHNILRKDYAIAIRYI         
fig|645462.3.peg.1501   Clostridium difficile CD196     NLQVIERNNER−−−VLT−−−−−−−−TQQLADVYETDVRNISNNFN−−−−−−−−−−−−−−−−−−−NNK−−−−−−−DRFIEGKHY−−−FLLQ−−−−GDDLKNFKGIHTEYENL−−−−−−−−−−−−−−−−KFT−−−−−SKMYLWT−−−−ERGANRHCKILDT−−DKAWEQFDNLEESYFNKKK−−−DTLITNQLSPELQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LFKQIFDTVAKQEIEQKQIKQD−−−ITETKQEIKSIKDVVTLNTTDWREETRKLIVSMAQN−−−−−−−−−−−−−−−−−−−−−−−−−−−LGGNEYINTLR−−−−−−−−−−−−−KESYELLCKRFNVDLKRRLNNRRSKMAEK           
fig|272563.8.peg.949   Clostridium difficile 630     NLQVIERNNER−−−VLT−−−−−−−−TQQLADVYETDVNNIQANFN−−−−−−−−−−−−−−−−−−−RNK−−−−−−−DRFKENIHY−−−FLLQ−−−−GEYLKEFKNQPTNSQLVS−−−−−−−−−−−−−−−KHS−−−−−SQLYLWT−−−−ERGANRHCKILDT−−DKAWEQFDNLEETYFKVKQ−−−−−−−HKPTCIED−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VLIESLKEMKDLRLQVNQANSI−−−ALEAKTEVETIKDVVSLDSNSWRTNTHQLIARIAKK−−−−−−−−−−−−−−−−−−−−−−−−−−−QGGFEHINMLR−−−−−−−−−−−−−TESYELLNKRFGVDLHRRLINKR                 
fig|272563.8.peg.3091   Clostridium difficile 630     NLQVIERNNKR−−−VLT−−−−−−−−TQQLADVYETDSKNISNNFN−−−−−−−−−−−−−−−−−−−NNK−−−−−−−DRFIEGKHY−−−FLLQ−−−−GDDLKNFKGIHTEYENL−−−−−−−−−−−−−−−−KFA−−−−−SKMYLWT−−−−ERGANRHCKILDT−−DKAWEQFDNLEETYFKVKQ−−−−−−−QKPTCIED−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VLIESLKEMKDLRLQVNQANN                                                                                                                                   
fig|499175.4.peg.2916   Clostridium difficile ATCC 43255     NLQVIERNNER−−−VLT−−−−−−−−TQQLADVYETDARNISNNFN−−−−−−−−−−−−−−−−−−−NNK−−−−−−−DRFIEGKHY−−−FLLQ−−−−GDDLKNFKGIHTEYENL−−−−−−−−−−−−−−−−KFT−−−−−SKMYLWT−−−−ERGANRHCKILDT−−DKAWEQFDNLEETYFKVKQ−−−−−−−HKPTCIED−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VLIESLKEMKDLRLQVNQANSI−−−ALEAKTEVETIKDVVSLDSNSWRTNTHQLIARIAKK−−−−−−−−−−−−−−−−−−−−−−−−−−−QGGFEHINMLR−−−−−−−−−−−−−TESYELLNKRFGVDLHRRLINKR                 
fig|585396.4.peg.5909   Escherichia coli O111:H- str. 11128        VLEWQGVR−−−−−VVT−−−−−−−−TETLARGYGTETIRIRQNHH−−−−−−−−−−−−−−−−−−−−−−−−−−ENKVRFVEGKHF−−−FKVE−−−−GESLRELKHRVALNYSVKIA−−−−−−−−−−−−−RNV−−−−−RSLTLWT−−−−ERGAARHAKMLET−−DQAWAFFEKLEDSYFRQKE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QQPIAIPQTLPEVLRLAAELAEQKQLLEQKAHQLNQQL                                                                                                                                 
fig|465517.10.peg.3654   Salmonella enterica subsp. enterica serovar Virchow str. SL491        VIVWEGVR−−−VVT−−−−−−−−TDTLAKGYGTDESNIRKNHS−−−−−−−−−−−−−−−−−−−−−−−−−−RNNSRFIEGIHI−−−FTVK−−−−GGELKSLRVTNSHAQISNKA−−−−−−−−−−−−−−−−−−−−−RSVTLWT−−−−EKGAARMSKIVDT−−DEAWSFFERLEDSYFRPATAVGIPLTYEAALED−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LLAKVKENRVITEQRDRAVKEKLWISE−−−−−−−KREATAMATASAEKRKANALAEKLGEC−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KKHATIKAVQRVTGKSFS               
fig|537973.8.peg.501   Lactobacillus paracasei subsp. paracasei 8700:2     EPQPIEQNGQR−−−VLT−−−−−−−−TEQLAELYGTTPNRIKNNFN−−−−−−−−−−−−−−−−−−−ENK−−−−−−−EKFAEGVHY−−−FKLE−−−−GNALKEFKSFVRNSDLPIN−−−−−−−−−−−−−KFS−−−−−PRLYLWT−−−−RRGAARHSKMLGT−−DQAWDMFDSLEENYFNPQN−−−−RIDTSGLSPATQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AAIATTQALAAQERRLNRVDAK−−−VD                                                                                                                             
fig|525338.3.peg.1688   Lactobacillus plantarum subsp. plantarum ATCC 14917     EVQQVKFNGDL−−−ILT−−−−−−−−TEQLAEFYGTTSRRITDNFN−−−−−−−−−−−−−−−−−−−ANR−−−−−−−DKFIEGTHY−−−FHLE−−−−GSQLKQFKNQTRKTGL−−VS−−−−−−−−−−−−−EHA−−−−−GAINLWT−−−−KRGASRHSKMLGT−−DQAWDMFDELEENYFDPKQ−−−−−−FALPTSPRE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IARLALQANEETNQRLDSVEGD−−−VK−−−−−−−DLKENQVIPNPEYSA−−−−LSRRVNQR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VSEVAHSYGHITQKQRGELFKDINGGIKKIANVSARSMLRKKDYQMVMDFINDWEP    
fig|644042.3.peg.966   Lactobacillus plantarum JDM1     EVQQVKFNGDL−−−ILT−−−−−−−−TEQLAEFYGTTSRRITDNFN−−−−−−−−−−−−−−−−−−−ANR−−−−−−−DKFIEGTHY−−−FHLE−−−−GSQLKQFKNQTRKTGL−−VS−−−−−−−−−−−−−EHA−−−−−GAINLWT−−−−KRGASRHSKMLGT−−DQAWDMFDELEENYFNPKQ−−−−−−FALPTSPRE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IARLALQANEETNQRLDSVEGD−−−VK−−−−−−−DLKENQVIPNPEYSA−−−−LNRRVNQR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VSEVAHSYGHITQKQRGELFKDIGSGIKKIANVSARSMLRKKDYQMVMDFINDWEP    
fig|525337.3.peg.1092   Lactobacillus paracasei subsp. paracasei ATCC 25302     EPQPIEQNGQR−−−VLT−−−−−−−−TEQLAELYGTTVGVVQMNFK−−−−−−−−−−−−−−−−−−−RNS−−−−−−−NKFIEGKHF−−−FKLK−−−−GEQLRAFKNEPTNCGF−−VG−−−−−−−−−−−−−KNA−−−−−SALYLWT−−−−RRGAARHSKMLGA−−EQAWDMFDSLEENYFNPKT−−−−−−−RLPQTPEE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KLALTTEVATRTVKRIEKLDGR−−−VT−−−−−−−DLEEKALLAPGEYNY−−−−ISKQVNRA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VANYLDVHHCKLNAKQRSLFYRDINHGLNDYIGIKTRTQLRKKDFDKADDFIQNWTP    
fig|1046597.4.peg.2652   Lactobacillus zeae KCTC 3804     EPQPIEQNGQR−−−VLT−−−−−−−−TEQLAELYGTTVGVVQMNFK−−−−−−−−−−−−−−−−−−−RNS−−−−−−−NKFIEGKHF−−−FKLE−−−−GEQLRAFKNEPTNCGF−−VG−−−−−−−−−−−−−KNA−−−−−SALYLWT−−−−RRGAARHSKMLGT−−DQAWDMFDSLEENYFNPKT−−−−−−−RLPQTPEE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KLALTMEVATRTVKRIEKLDGR−−−VT−−−−−−−DLEEKALLAPGEYNY−−−−ISKQVNRA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VANYLDVHHCKLNAKQRSLFYRDINHGLNDYIGIKTRTQLRKKDFDKADDFIQNWTP    
fig|321967.8.peg.505   Lactobacillus casei ATCC 334     EPQPIEQNGQR−−−VLT−−−−−−−−TEQLAELYGTTVGVVQMNFK−−−−−−−−−−−−−−−−−−−RNS−−−−−−−NKFIEGKHF−−−FKLE−−−−GEQLRAFKNEPTNCGF−−VG−−−−−−−−−−−−−KNA−−−−−SALYLWT−−−−RRGAARHSKMLGT−−DQAWDMFDSLEENYFNPKT−−−−−−−RLPQTPEE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KLALTMEVATRTVKRIEKLDGR−−−VT−−−−−−−DLEEKALLAPGEYNY−−−−ISKQVNRA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VANYLDVHHCKLNAKQRSLFYRDINHGLNDYIGIKTRTQLRKKDFDKADDFIQNWTP    
fig|1256209.3.peg.2417   Lactobacillus paracasei subsp. paracasei Lpp221     EPQPIEQNGQR−−−VLT−−−−−−−−TEQLAELYGTTVGVVQMNFK−−−−−−−−−−−−−−−−−−−RNS−−−−−−−NKFIEGKHF−−−FKLE−−−−GEQLRAFKNEPTNCGF−−VG−−−−−−−−−−−−−KNA−−−−−SALYLWT−−−−RRGAARHSKMLGT−−DQAWDMFDSLEENYFNPKT−−−−−−−RLPQTPEE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KLALTMEVATRTVKRIEKLDGR−−−VT−−−−−−−DLEEKALLAPGEYNY−−−−ISKQVNRA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−VANYLDVHHCKLNAKQRSLFYRDINHGLNDYIGIKTRTQLRKKDFDKADDFIQNWTP    
fig|272623.1.peg.1036   Lactococcus lactis subsp. lactis Il1403     ELQITELNGQR−−−VLT−−−−−−−−TQQIAEGYGTDSASITKNFN−−−−−−−−−−−−−−−−−−−NNK−−−−−−−SRFKEGKHF−−−FLLQ−−−−GADLKEFKNNIQNLDV−−VG−−−−−−−−−−−−−NRA−−−−−PKLYLWT−−−−EKGALLHAKSLGT−−DEAWDMYDILVDTYFKVQE−−−−−EKQLPQTPEQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QIALLAQGNVNLNKKVEQIENS−−−VL−−−−−−−DLTDRFGLPSNKAKV−−−−LQKKVASK−−−−−−−−−−−−−−−−−−−−−−−VYMFTGGKY−−−−−−SNAHKKLGAKVFREFYKDLNNRFDVVKYSDIPLSRYDEATEYLDMWQP    
fig|272622.10.peg.1267   Lactococcus lactis subsp. cremoris SK11     ELQITELNGQR−−−VLT−−−−−−−−TQQIADGYGTTNKVISNNFN−−−−−−−−−−−−−−−−−−−NNR−−−−−−−TRFEEGKHF−−−VLLV−−−−GEYLKEFLHSQNLG−−−TQ−−−−−−−−−−−−−NKI−−−−−RKLYLWT−−−−EKGALLHAKSLGT−−DEAWDMYDILVDTYFKVQE−−−−−EKQAPLTLDQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QIAAIATGYGSVKEELVEVKDR−−−VS−−−−−−−DLEENAPLSAGEYNY−−−−IGSRINQR−−−−−−−−−−−−−−−−−−−−−−−VAEVARGY−−−−−−GKITREQRGKLFKDINQGVKVVTGVSTRTQLRAKHFDTVVDFTNNWDP    
fig|491915.4.peg.661   Anoxybacillus flavithermus WK1     NLTVIEQNGQR−−−VLT−−−−−−−−TQQLAEAYGTDTERIRINFN−−−−−−−−−−−−−−−−−−−RNK−−−−−−−DRFVEGKHF−−−FALT−−−−GQEKHEFINSYQIDT−−−TW−−−−−−−−−−−−−LKA−−−−−PVFYIWT−−−−EKGAWLHAKSLNT−−DEAWEAYERLVDEYYTIKE−−−NALNIQMLSPQLQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ALISIELRQKQLEQEL                                                                                                                                        
fig|279010.12.peg.3705   Bacillus licheniformis ATCC 14580     NLSIIEKNNQR−−−VLT−−−−−−−−TTQLAESYGTNNRRISENFK−−−−−−−−−−−−−−−−−−−RNI−−−−−−−NRFKEGKHF−−−YSLQ−−−−GKEKRDFINHTQIED−−−GS−−−−−−−−−−−−−KNA−−−−−QTLYLWT−−−−EKGAWLHAKSLNT−−DQAWDAYEMLVDEYYNVKQ−−−TQIDTSQLSPELQMFKQIFD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SVARTQLKQQEQDKRLDAVEKK−−−QD−−−−−−−NIKEVLSLNPTEWKKKVNKIINAIALS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KGGFQAYADVRKESYQLL             
fig|476272.5.peg.2828   Blautia hydrogenotrophica DSM 10507                                                                                                                                                KVFIT−−−−ESGYLMLVKSFTD−−DLAWTVQRQLVDSYFRVNR−−−−−−−−−RMTPEE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MMRVQLGMLDGHEERISRLENT−−−−−−−−−−−−−−−−−MNIDYGQQRV−−−−LEKEVAAV−−−−−−−−−−−−−−−−−−−−−−−VIESLGGKD−−−−−−STAYHEISKKVFSECNRDVKDYFHVNSRNNIPRLRFDDAVDYIRNWTP    
fig|469621.8.peg.1905   Fusobacterium periodonticum 1_1_41FAA       MVKEFQGQR−−−−−VVT−−−−−−−−AWDIAKVHEREVNDVTKNFN−−−−−−−−−−−−−−−−−−−−−−−−−−NNRSKFILGEDY−−−FLIN−−−−RTEISERKISIQEFIPNNV−−−−−−−−−−−−−−−−−−−−−−KEIPLFT−−−−ESGYLMLVKTFTD−−DLSWKVQRELVKGYFIAKE−−−−−−VIKPLTPAE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QLLAQAKVMVDMENRLNILEKNNARLE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NHLRRTITNEYFTVIGYANFRGINANTYNSS             
fig|431943.4.peg.3331   Clostridium kluyveri DSM 555        VKEFKGQR−−−VVT−−−−−−−−FKDIDMLHERIEGTAKRNFN−−−−−−−−−−−−−−−−−−−ENKYEDDRKTERFINGVDY−−−FIVT−−−−TSEKDEIRT−−−−−−−−−LE−−−−−−−−−−−−−IPN−−−−−RGLTLIT−−−−ESGYLMLVKSFTD−−DLAWKVQRELVNSYFRGKE−−−−−−−QKQLSPME−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QLRLQYQVIEQ−−−−HEEKINELDIK−−−VE−−−−−−−SLALTMNISDGQAKT−−−−IQKLVNKR−−−−−−−−−−−−−−−−−−−−VKALCYGDESSAYMN−−−−−−−TSIRKKVYSYIWRTLKDYLNVTVYHNILRKDYSSALKYINA       
fig|344610.3.peg.1805   Escherichia coli 53638        VIEYRGQR−−−VVT−−−−−−−−LAMIDEVHQRPDGTAGRNFR−−−−−−−−−−−−−−−−−−−ENK−−−−−−−SRLIEGEDY−−−FELG−−−−SDEIRRHLPD−−−−−−−−−−−−−−−−−−−GTFSKFA−−−−−AAGIVLV−−−−ESGYLMLVKSFTD−−DLAWQVQRELVNSYFRTHA−−−−−−−−−PLTEME−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MIAAMAADAVRQQKRLSHVEKK−−−IET                                                                                                                            
fig|344610.7.peg.4315   Escherichia coli 53638        VIEYRGQR−−−VVT−−−−−−−−LAMIDEVHQRPDGTAGRNFR−−−−−−−−−−−−−−−−−−−ENK−−−−−−−SRLIEGEDY−−−FELG−−−−SDEIRRHLPD−−−−−−−−−−−−−−−−−−−GTFSKFA−−−−−AAGIVLV−−−−ESGYLMLVKSFTD−−DLAWQVQRELVNSYFRTHA−−−−−−−−−PLTEME−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MIAAMAADAVRQQKRLSHVEKK−−−IET                                                                                                                            
fig|766158.3.peg.791   Shigella flexneri 2850-71        VIEYRGQR−−−VVT−−−−−−−−LAMIDEVHQRPDGTAGRNFR−−−−−−−−−−−−−−−−−−−ENK−−−−−−−SRLIEGEDY−−−FELG−−−−SDEIRRHLPD−−−−−−−−−−−−−−−−−−−GTFSKFA−−−−−AAGIVLV−−−−ESGYLMLVKSFTD−−DLAWQVQRELVNSYFRTHA−−−−−−−−−PLTEME−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MIAAMAADAVRQQKRLSHVEKK−−−IET                                                                                                                            
fig|344610.7.peg.4751   Escherichia coli 53638        VIEYRGQR−−−MVT−−−−−−−−LAMIDEVHQRPDGTAGRNFR−−−−−−−−−−−−−−−−−−−ENK−−−−−−−SRLIEGEDY−−−FELG−−−−SDEIRRHLPD−−−−−−−−−−−−−−−−−−−GTFSKFA−−−−−AAGIVLV−−−−ESGYLMLVKSFTD−−DLAWQVQRELVNSYFRTHA−−−−−−−−−PLTEME−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MIAAMAADAVRQQKRLSHVEKK−−−IET                                                                                                                            
fig|156889.7.peg.1370   Magnetococcus sp. MC-1        VIEYKGSR−−−VVT−−−−−−−−FAMVDQVHQRPEGTAKRNFH−−−−−−−−−−−−−−−−−−−DNR−−−−−−−PRFEENVDF−−−AKIS−−−−KDEFRTDLWESFG−−−−−FS−−−−−−−−−−−−−KFA−−−−−SSGILLT−−−−QTGYLMLVKSFTD−−DLAWKVQRELVNRYFRTA−−−−−−−−−−PTSTAH−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QLYLMAKANWEQEQRLSQIAE                                                                                                                                   
fig|156889.7.peg.2941   Magnetococcus sp. MC-1        VIEYKGSR−−−VVT−−−−−−−−FAMVDQVHQRPEGTAKRNFH−−−−−−−−−−−−−−−−−−−DNR−−−−−−−PRFEENVDF−−−AKIS−−−−KDEFRTDLWESFG−−−−−FS−−−−−−−−−−−−−KFA−−−−−SSGILLT−−−−QTGYLMLVKSFTD−−DLAWQVQRELVNRYFQAA−−−−−−−−−−PTSTAH−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QLYLMAKANWEQEQRLSQIAE                                                                                                                                   
fig|156889.7.peg.2148   Magnetococcus sp. MC-1        VIEYKGSR−−−VVT−−−−−−−−FAMVDQVHQRPEGTAKRNFH−−−−−−−−−−−−−−−−−−−DNR−−−−−−−PRFEENVDF−−−AKIS−−−−KDEFRTDLWESFG−−−−−FS−−−−−−−−−−−−−KFA−−−−−SSGILLT−−−−QTGYLMLVKSFTD−−DLAWQVQRELVNRYFQAA−−−−−−−−−−PTSTAH−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QLYLMAKANWEQEQRVNQL                                                                                                                                     
fig|762051.3.peg.1862   Leuconostoc kimchii IMSNU11154                                   IADIHSKSTKAINQAIN−−−−−−−−−−−−−−−−−−−−−−−−−−MNIKRFKTGVDL−−−IDLKQKDFEVNQIDLGFSQN−−−−−SI−−−−−−−−−N−−−RS−−−−−−SHIYMLS−−−−ERGYSKLLKILED−−DIAWDIYDKFVDGYFNMRK−−−−−−−−−AFKQPK−−−−−−−−−−−−−−−−SPMD−−−−−−−−−−−−−−−−−−−−−−−−−FIKLHNEAFIEVDERVGVLEDF−−−KK−−−−−−−DYDENRTINEDQVIQ−−−−IEKARKSK−−−−−−−−−−−−−−−−−−−−−−−AMKIVGGVA−−−−−−TNAYKEFYSDILRKKLFPDFRKRFNVNRYRSLKAKEFNEAIMFIQNWQP    
fig|632245.3.peg.2175   Clostridium butyricum E4 str. BoNT E BL5262                                KSNYAECVSANI−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NKLYLWT−−−−DRGAARHAKILDT−−DEAWDVYESLEENYFNPIQK−−−−−−−−−QLS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−PMDQLR−−−−−−L−−−−−QYQVLEN−−−−HETEIKEVKGE−−−VK−−−−−−−HLKDNMPLFNIDCDE−−−−LQKEVKKI−−−−−−−−−−−−−−−−−−−−−−−GVEALGGKD−−−−SVAYKDKSIRTKVYTDIQHQVKRQFDVRSYKAIKRSQLEIAKDIIKNY      
fig|315749.4.peg.3032   Bacillus cereus subsp. cytotoxis NVH 391-98                                  EIAEIHEKEVKHINLRIN−−−−−−−ENR−−−−−−−−−SRFKD−−−−−−−−−−GIDI−−−VDLK−−−−GTIF−−−−EVGL−−−−−TDHNILSKMMVS−−−KS−−−−−−NNIYLLS−−−−ERGYAKLLKILED−−DTAWELYDQFVDGYFNMRE−−−−−−−−−Q−−−QP−−−−−−−−−−−−R−−−VLNE−−−−−−−KESLLANMQATIL−−−−−LNEEVST−−−−MKEDMNSVKAE−−−VK−−−−−−−DLKENTPLYATECDE−−−−IVKTVNKT−−−−−−−−−−−−−−−−−−−−−−−AVRLLGGKQ−−−−SNAYQNKSTRGKVYKDIYRELRRHFDVKSYKAIKRRYLEAAKKKI         
fig|1279365.3.peg.253   Bacillus thuringiensis serovar kurstaki str. HD73                                                                                                                                  N−−−QS−−−−−−KNIYLLS−−−−ERGYAKLLKILED−−DTAWELYDQFVDGYFNMRE−−−−−−−−−−−−−QK−−−−−−−−−−−−Q−−−IPTD−−−−−−−PMSILK−−−−−−L−−−−−TFDALEG−−−−QKQELQHIKSD−−−VK−−−−−−−DLRENAPLFAVECDE−−−−ISNAVKRY−−−−−−−−−−−−−−−−−−−−−−−GVVLLGGKN−−−−SNAYQDRGLRSKVYKDIYRQLYREFGVTSHKAIKRGHLELASKIV         
fig|526976.3.peg.1102   Bacillus cereus BDRD-ST196                                                                                                                                                 YILS−−−−ERGYAKLLKILED−−DTAWELYDQFVDGYFNMRE−−−−−−−−−−−−−QK−−−−−−−−−−−−Q−−−IPND−−−−−−−PMSILK−−−−−−L−−−−−TFEAMEG−−−−QKQEIQHIKTD−−−VK−−−−−−−DLRENAPLFAIECDE−−−−ISNAVKRC−−−−−−−−−−−−−−−−−−−−−−−GVTLLGGKN−−−−SNAYRDSSVRDKVYKDIYRQLRRHFDVKSYKAIKRRYLEAAKNIVAEYELPMV 
fig|483216.6.peg.3182   Bacteroides eggerthii DSM 20697     EDKIITLRGQK−−−−−VLL−−−−−−−−DRDVAALYGVETRDINKSVR−−−−−−−−−−−−−−−−−−−−−−−−−−NNPDKFPKGYV−−−IELNDSEL−−−−KGLRWKNST−−−−−T−−−−−−−−NLS−−−KSR−−−−−VLPKAFT−−−−EKGLYMIATILKS−−ARATEATISIIETFAKLRE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LSRTLNNLPDASEEQQKSLLEK−−−SGDLFTDLLDNNLQATDSETTIELNLAVLKVKHTVKRK                                                                                         
fig|483215.6.peg.3485   Bacteroides finegoldii DSM 17565     ENKIYEIRGQK−−−−−VML−−−−−−−−DFDLAEMYEIETKNLKRTVK−−−−−−−−−−−−−−−−−−−−−−−−−−RNINRFPADFM−−−FQLTKAEANLLINNIRCQNGT−−−−−−−−−−−−−LEIN−−−WFR−−−−−YQPYAFT−−−−EQGVAMLSGLLNS−−EKAIEVNINIMRAFVHMRQ−−−−−−−−−YLLSHAPKQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ELEELRKRIEYLEEDI                                                                                                                                        
fig|471870.8.peg.928   Bacteroides intestinalis DSM 17393     ENKIYEIRGQK−−−−−VML−−−−−−−−DFDLAKMYEVETKYLKQMVR−−−−−−−−−−−−−−−−−−−−−−−−−−RNAERFPEDFM−−−FQLSNEEVNCLISSLRLQIAI−−−−−−−−−−−−−SNKG−−−GTR−−−−−YSPFAFT−−−−EQGVAMLSGILRS−−PKAIEVNINIMRAFVRMRQ−−−−−−−−−YLLSHVPKQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ELEELRKRIEYLEEDVTSDRDSYEKQFDELFSAFAK                                                                                                                    
fig|457390.3.peg.2131   Bacteroides sp. 3_1_23     ENKIYEIRGQK−−−−−VML−−−−−−−−DFDLAEMYGVETKRLKEQVR−−−−−−−−−−−−−−−−−−−−−−−−−−RNIERFPAEFM−−−FELTKEEV−−−−AISRSQIAT−−−−−−−−−−−−−LKTGQGYNIK−−−−−YLPFAFT−−−−EYGIVMLSSVLKS−−KTAVEVNINIIRAFVRMRQ−−−−−−−−−YLLSNIPKK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ELEELKQRIEYLEEDITSDRESYEKQFDDLFNAFAK                                                                                                                    
fig|511680.4.peg.1833   Butyrivibrio crossotus DSM 2876        VYILRGQQ−−−−−VML−−−−−−−−DQDLAEIYGYQVKNLNQQVK−−−−−−−−−−−−−−−−−−−−−−−−−−RNLTRFPEDFM−−−FQLTKEEV−−−−ELVKSQFVT−−−−−SRNINYFEGQEG−−−GRR−−−−−KLPYAFT−−−−EQGIYMLAAVLRG−−ELAEQQSIFIMRTFREMRH−−−−−−−−−YISQNQQFVTRN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EMELLTAKVGTITERQDRMEKKVD                                                                                                                                
fig|575609.3.peg.1037   Peptoniphilus sp. oral taxon 386 str. F0131      NKIYTIRGQK−−−−−VML−−−−−−−−DFELAEIYGYETKRFNEQVK−−−−−−−−−−−−−−−−−−−−−−−−−−NNIEKFDDDFR−−−FQLTKEEW−−−−EFLRSKIST−−−−−SKS−−−−EAGSG−−−GRR−−−−−YLPFAFT−−−−EQGIYMLMTVLKG−−ELAVKQSKALIRTFKQMKD−−−−−−−−−YIVENQGLIGKR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EFLQLSMQITSNVVEMQDLRRDLRDVEDQVAEVMDTLNNVVHKSELSDLILDLSNPQLKYGFLLLNGQPIEANLAYKDIYS                                                                       
fig|679192.3.peg.275   Bulleidia extructa W1219      KKIYIIRGQK−−−−−VML−−−−−−−−DFELAEIYGYETKNFNRQVK−−−−−−−−−−−−−−−−−−−−−−−−−−NNIEKFEGEDFM−−−LRITEEEM−−−−DNLRCKIFT−−−−−S−−−−−−−−SWG−−−GTR−−−−−YLPYAFT−−−−EQGIYMLMTVLKG−−DLAVRQSRALIRTFKQMKD−−−−−−−−−YIVENQGLIGKR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EFLQLSIQIANNVVEMQNLRRDLMNVEDQVAE                                                                                                                        
fig|469589.3.peg.2099   Bacteroides sp. 2_1_33B        IYNIRGVR−−−−−VML−−−−−−−−DMDLANIYGYSTKDFNRQVK−−−−−−−−−−−−−−−−−−−−−−−−−−NNIEKFEQDFM−−−FQLFDEEC−−−−EILRCKNST−−−−−S−−−−−−−−SWG−−−GRR−−−−−YNPYAFT−−−−EQGIYMLMTVLRG−−DLATKQSKALIRIFKQMKD−−−−−−−−−YIVDNQPLLGQR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EYLQLSLQTTQNTQDLLDLRKSLSAVDDKVAN                                                                                                                        
fig|575609.3.peg.1069   Peptoniphilus sp. oral taxon 386 str. F0131      EKIYFIRGQK−−−−−VML−−−−−−−−DSDLAEIYGYETKMFNRQVK−−−−−−−−−−−−−−−−−−−−−−−−−−RNIEKFEGDDFM−−−FQLTDEEVY−−−ELSRCHFGT−−−−−L−−−−−−−−NNG−−−QGRGSNIKYKPYAFT−−−−EQGIYMLMTVLRG−−ELAIRQSRALIRMFKQMKD−−−−−−−−−YIVENRDFLSSK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−EMVQLLLQTNKNTNDIMQHSKE                                                                                                                                  
fig|596329.3.peg.1632   Peptostreptococcus anaerobius 653-L      EKIYFIRGQK−−−−−VML−−−−−−−−DSDLAEIYGYETKNFNRQVK−−−−−−−−−−−−−−−−−−−−−−−−−−NNAEKFEGEDFM−−−FQLTDQEMV−−−ELSRCKNFT−−−−−L−−−−−−−−NRG−−−TGRGSNIKYNPYAFT−−−−EQGIYMLMTVLRG−−ELAVKQSRALVRTFKQMKD−−−−−−−−−FIIENQDFIGSK−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ELVQIIVQTNQNTKDIAEIKSQM                                                                                                                                 
fig|1001739.3.peg.1784   Mycobacterium abscessus 6G-0212     ELVFMGDNGEP−−−−−FTT−−−−−−−−SMVVAAETENEHASVIKTVR−−−−−−−KHLSDLNEVGRVRFEIQPFETAGG−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−TQR−−−−−REVAQLD−−−−EPAAALLITNLKGSPVVWDFRKRLVAGFYAMRQ−−−−−−−−−KLAERSAAHPLQGPELLAA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AVLESQKMIEQRDARIHQLEQKAIEAA                                                                                                                             
fig|193567.3.peg.1249   Streptococcus pyogenes SSI-1        IFNFNGQK−−−VRTLTINNEPYFVGKDVADVLGYQNPQ−−KAIRDHVDFDDKLTEQIV−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QS−−−−−−−−−−−−−GQN−−−−−REMIIIN−−−−ESGLYSLILSSKL−−QQAKEFKRWVTSEVLPQIRK−−−−−−−−−−−−−−−−−−−−−−−−−−−QGAYVPENLSDE−−−−−−−−−−−−−−−−−−−−−AFIALFQGQKKLKQQQQELAQD−−−VD−−−−−−−YLKNEQPIHPSFAQA−−−−LLKKRKSR−−−−−−−−−−−−−−−−−−−−−−−VVMWLGGID−−−−SPAYGDKVFAQSVFREAEMDFKAHFNVSRYDMLPKKFEDAALSYWMTWEP    
fig|445334.5.peg.419   Clostridium perfringens C str. JGS1495                                                                                                                                                            FYLLAMKANN−−EVARKFQTWLAVEVIPAIRK−−−−−SGQYQLEKKPTSAIDLFEA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QVQAFKE−−−−VKQQINEVNHRVLEASAKSDKLEERMDNQTLSTAQTKK−−−−LKKLANSL−−−−−−−−−−−−−−−−−−−−−−−AVPLVGGKG−−−−−−SKAYEPMIRKVYMDIYRQLFRELGVKASDEIKVKDFNFALEVMNDYK     
fig|195103.10.peg.899   Clostridium perfringens ATCC 13124        IQNQNKNGKLYISIRWETINNYCKEFNFPNKLGKDD−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−FIP−−−−ESLFYLLAMKANN−−EVARKFQTWLAVDVIPQIRK−−−−−−−−−−−−−−−−−−−−−−−−−NGQYQMKPTS−−−−−−−NLELLEL−−−−−−−−−−−QVKALRE−−−−VEERVIEVDKK−−−−−−−−−−−−−−FDDLPLFEIDSKD−−−−LKKKVNRV−−−−−−−−−−−−−−−−−−−−−−−VVSLLGGKK−−−−−−SNAYKPLSKKVFSDLYGQIHREFGVDTCAAIKRKDLDLAKEIVDSY      
fig|313606.3.peg.2302   Microscilla marina ATCC 23134     LLPIEIKNEMP−−−−−VVD−−−−−−−−SRLVAETLGIKHKALMATIR−−−−−−−RYQ−−−−−−−−−−−−−−−−−−−−−−AKIEEF−−−GSLP−−−−FETEVRKRDVGAT−−−−−TL−−−−−−−−−−−−−−−−−−−−−RFCYLSE−−−−NQAIFIGTLSRNT−−KKVVAFKSKLIQSFDHVRK−−−−−−−−−TVQGQPFNQKLWVQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AVKNLCELTKSTKETKREIKILNSRQTFLAHEISSIRDA                                                                                                                 
fig|313606.3.peg.3519   Microscilla marina ATCC 23134     LLPIEVKNEIP−−−−−VVD−−−−−−−−SRLVAEALGVKHKALMATIQ−−−−−−−RYQ−−−−−−−−−−−−−−−−−−−−−−AKIEEF−−−GSLP−−−−FETEVKKRDVGAT−−−−−TL−−−−−−−−−−−−−−−−−−−−−RFCYLNE−−−−NQAIFIGTLSRNT−−KKVVAFKSRLVQSFAYVRK−−−−−−−−−TIQEQPFNQRILVQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AVKNLHELAKSTKETRGQIK                                                                                                                                    
fig|313606.3.peg.2173   Microscilla marina ATCC 23134     LLPIEIKNEMP−−−−−VVD−−−−−−−−SRLVAETLGIKHKALMATIR−−−−−−−RYQ−−−−−−−−−−−−−−−−−−−−−−AKIEEF−−−GSLP−−−−FETEVRKRDVGAT−−−−−TL−−−−−−−−−−−−−−−−−−−−−RFCYLSE−−−−NQAIFLGTLSRNT−−KKVVAFKSKLIQSFDQVRK−−−−−−−−−TVQGQPFNQKLWVQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AVKNLCELTKSTKETKREIKILNSRQTFLAHEISSIRDA                                                                                                                 
fig|313606.3.peg.6262   Microscilla marina ATCC 23134     LLPIEIKNEMP−−−−−VVD−−−−−−−−SRLVAETLGIKHKALMATIR−−−−−−−RYQ−−−−−−−−−−−−−−−−−−−−−−AKIEEF−−−GSLP−−−−FETEVRKRDVGAT−−−−−TL−−−−−−−−−−−−−−−−−−−−−RFCYLSE−−−−NQAIFLGTLSRNT−−KKVVAFKSKLIQSFDHVRK−−−−−−−−−TVQGQPFNQKLWVQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−AVKNLCELTKSTKETKREIKILNSRQTFLAHEISSIRDA                                                                                                                 
fig|515621.3.peg.2091   Clostridium botulinum Ba4 str. 657      ELQVLNNKNL−−−−−TLE−−−−−−−−STEVSEMTGKEHKNLMRDIR−−−−−−−NYV−−−−−−−−−−−−−−−−−−−GILEGSNLS−−−SHDY−−−−FIES−−−−TYIN−−−−−SQ−−−−−−−−−N−−−KE−−−−−−QPCYLLT−−−−KMGCEMVANKMTG−−KKGVLFTAKYVKRFNQIEQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NELPKIST−−−−−−−−−−−−−−−−−−−−−−−ELRAILM−−−−LDNKTIEIEEK−−−VT−−−−−−−NLENNIPLFNVECKE−−−−LQALVRKV−−−−−−−−−−−−−−−−−−−−−−−GIKTLGGYK−−−−TPAYNDRSLRTKVYTDIQHQLKREFGVTRYEAIKRKQLDKAKEIL         
fig|413999.4.peg.1598   Clostridium botulinum A str. ATCC 3502      ELQVLNNKNL−−−−−TLE−−−−−−−−STEVSEMTGKEHKNLMRDIR−−−−−−−NYV−−−−−−−−−−−−−−−−−−−GILEGSNLS−−−SHDY−−−−FIES−−−−TYIN−−−−−SQ−−−−−−−−−N−−−KE−−−−−−QPCYLLT−−−−KMGCEMVANKMTG−−KKGVLFTAKYVKRFNQIEQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NELPKIST−−−−−−−−−−−−−−−−−−−−−−−ELRAILM−−−−LDNKTIEIEEK−−−VT−−−−−−−NLENNIPLFNVECKE−−−−LQALVRKI−−−−−−−−−−−−−−−−−−−−−−−GIKTLGGYK−−−−TPAYNDRSLRTKVYTDIQHQLKREFGVTRYEAIKRKQLDKAKEIL         
fig|536227.4.peg.370   Clostridium carboxidivorans P7     NKLSNVVEKDL−−−TID−−−−−−−−SREVAKMLGKEHGDLLKDIH−−−−−−−GSG−−−−−−−−−KNLG−−−−IIPVLLKENFP−−−VSDY−−−−FIES−−−−NYKD−−−−−SS−−−−−−−−−G−−−KV−−−−−−NKCYNCT−−−−KMGCEMLGNKLQG−−AKGILFTAKYVKKFNQMEN−−−−−−−−−LVRDKQ−−−−−−−−−−−−T−−−−−−−−−−−−−−−−−−−Q−−−−−−L−−−−−SIKEIQE−−−−LKNALSELKKA−−−IEE                                                                                                                            
fig|536232.3.peg.1504   Clostridium botulinum A2 str. Kyoto      ELQVLNNKNL−−−−−TLE−−−−−−−−SIEVTRMLGKEHKQLLREIR−−−−−−−DIS−−−−−−−−−−−−−−−−−−−NILESENFS−−−PSKY−−−−FIES−−−−EYIT−−−−−AQ−−−−−−−−−N−−−KK−−−−−−HPCYLVT−−−−KMGCELLGNKLQG−−AKGTIFTAEYVERFNQMEN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−IKIPKLSK−−−−−−−−−−−−−−−−−−−−−−−EVQAIFT−−−−LDNRTMEIEEK−−−VT−−−−−−−NLENNIPLFNVECKE−−−−LQALVRKV−−−−−−−−−−−−−−−−−−−−−−−GIKTLGGYK−−−−TSAYNDRSLRTKVYSDIQGQLRREFGVTRYEAIKRKQLNKAKEILENY      
fig|632245.3.peg.3271   Clostridium butyricum E4 str. BoNT E BL5262      LRIFNYIGRN−−−VTD−−−−−−−−SREVADGTGKNHAHLMRDIK−−−−−−−VYI−−−−−−−−−−−−−−−−−−SAISTNPKLD−−−SLDF−−−−FIES−−−−TYKD−−−−−GK−−−−−−−−−G−−−EI−−−−−−RPCYLLT−−−−KQGCEMVANKMTG−−EKGISFTAEYVQAFNKMEQ−−−−−−−−−YIPQVN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MSKELQAILMVDNKAEELKNNIAEVKTD−−−LE−−−−−−−DFKDNAPLFNAECKE−−−−LQALVKKM−−−−−−−−−−−−−−−−−−−−−−−GVKSLGGKG−−−−SAAYKNNSIRCKVYQDIQGQLRREFGVNRYEYIKRCQLSQAINII         
fig|428127.7.peg.1346   Eubacterium dolichum DSM 3991     ELKVYDFRGKK−−−VTD−−−−−−−−SRIVAEMIGVQHKNLLQKIK−−−−−−−GYE−−−−−−−−−−−−−−−−−−−EILLSSKFS−−−SVEF−−−−FIPS−−−−EYKD−−−−−ST−−−−−−−−−G−−−RN−−−−−−LKCYLLT−−−−KKGCEMVANKLTG−−EKGILFTAQYVEAFNEMET−−−−−−−−−NMNLKS−−−−−−−−−−−−−−−KLPTS−−−−−−−DLELLK−−−−−−L−−−−−AVSAIDE−−−−TDKKIVALETK−−−VE−−−−−−−QKFDEMPLFGVDQDE−−−−IRHAINVK−−−−−−−−−−−−−−−−−−−−−−−VISCLGGKE−−−−SKAYTDNSIRGKVYSDIHCQIRREFDVDTYKAIPRKNVETAIEVIHGYK     
fig|362948.14.peg.1747   Lactobacillus salivarius UCC118           VNTNV−−−−−TLD−−−−−−−−SRLLAKGLKMEHYNLLKMIR−−−−−−−KSINYLERMQKDFNTINTTPVKIDGCKNPYS−−−TELY−−−−FIED−−−−KYINP−−−−−ST−−−−−−−−−−−−−TQE−−−−−IPFYHVT−−−−IKGCELVAHKMTG−−YKGTKFTVMYINEFHKLSE−−−−−−−−−QDQKQN−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−SNKIVSNIFNQSFNTPNQEPQQTELLQDESSELTPLQQDMNYLQQRINR                                                                                            
fig|642492.3.peg.828   Clostridium lentocellum DSM 5427           KNGQA−−−IETIS−−−−−−−−SIEVSEMVEKPHNDLLKDIR−−−−−−−RYI−−−−−−−−−−−−−−−−−−−TQLAEGNLS−−−HSEF−−−−FIES−−−−TYLD−−−−−AN−−−−−−−−−−−−−RQS−−−−−RTCYQVT−−−−RKGCELIANKLIG−−TKGTCFTARYVNRFHSMEN−−−−−−−−−YIKQKESYQIDDPIERA−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−KAWILEQ−−−−QEKQVLQLENKQQQQI                                                                                                                             
fig|1158480.3.peg.1798   Staphylococcus aureus M1253      LQIVEQNETH−−−YVD−−−−−−−−SREVAEMIGKRHDNLVRDIK−−−−−−−GYI−−−−−−−−−KVLE−−−DSSK−−−−−LS−−−SHNF−−−−FEES−−−−TYVN−−−−−SQ−−−−−−−−−N−−−KV−−−−−−QPCYLLT−−−−KKGCDIVANKMTG−−SKGILFTATYVDAFHKMDE−−−−−−−−−YIKQQA−−−−−−−−−−−−QLNVPQT−−−−−−−PMQALE−−−−−−M−−−−−MFKAQKD−−−−QEQFNKQMQQE−−−IT                                                                                                                             
fig|445337.5.peg.1816   Clostridium botulinum C str. Eklund     ELKVINQNGKL−−−LTD−−−−−−−−SRDVARMVDKKHSHLMRDIR−−−−−−−GYI−−−−−−−−−−−−−−−−−−−EILRESNLG−−−FSDF−−−−FIES−−−−TYKTE−−−−−GN−−−−−−−−−N−−−KT−−−−−−YECYLVT−−−−KKGCEMIANKMIG−−KKGVLFTATYVDAFNKMEE−−−−−−−−−SLRQIT−−−−−−−−−−−−−TYKLPQT−−−−−−−YAEALR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−ELADR                                                                                                                                  
fig|526998.3.peg.5624   Bacillus mycoides Rock1-4           KANEL−−−YID−−−−−−−−SLEVAEMTGKRHADLLRDID−−−−−−−NY−−−−−−−−−−KLILE−−−NAK−−−−−−LR−−−SQGF−−−−FVES−−−−SYKTN−−−−−GN−−−−−−−−−N−−−KT−−−−−−YKSYLLT−−−−RKGCDMVANKMTG−−EKGILFTASYIERFHEMES−−−−−−−−−TIHQPQ−−−−−−−−−−−−−−−−LPTT−−−−−−−YKAALI−−−−−−Q−−−−−LVEQVEA−−−−NEQLQSQLTEQAPKVE                                                                                                                             
fig|526974.3.peg.2632   Bacillus cereus BDRD-ST24     NNLQVNNQEVN−−−FID−−−−−−−−SLEVANMTGKRHDHLLRDID−−−−−−−NYM−−−−−−−−−DIFLT−−−NPN−−−−−−LG−−−ALDY−−−−FRKA−−−−TYLD−−−−−LK−−−−−−−−−G−−−EP−−−−−−RRKYLLT−−−−RKGCELVANKMTG−−EKGILFTVAYIDKFHEMEK−−−−−−−−−AIQQPA−−−−−−−−−−−−−−−−LPTT−−−−−−−YKEALL−−−−−−Q−−−−−LVEQVEA−−−−TEKLQAQLEEQAPAIEYHDKVLNIEGYMTIDETAKELGLRSAQQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−LNQMLKGKKVIKRSSRGSWLHRAGYEYLKD−−−−−−−−−GYINYKPIEKKKLQ               
fig|499175.4.peg.1171   Clostridium difficile ATCC 43255      LKIVKVNNKL−−−TTD−−−−−−−−SRDIALMVEKEHKILLRDIR−−−−−−−NYI−−−−−−−−−NQME−−−EANKNMSTDLY−−−PSDY−−−−FIEN−−−−TYLD−−−−−DY−−−−−−−−−K−−−RE−−−−−−KPCYAIT−−−−KIGCDFIANKMTG−−IKGTAFTGIYTKKFEEMEQ−−−−−−−−−VLKNEQ−−−−−−−−−−−−T−−KLPTT−−−−−−−YKEALQ−−−−−−H−−−−−LIEQVEV−−−−NEQLQLEGKMK−−−DQ                                                                                                                             
fig|500635.8.peg.80   Mitsuokella multacida DSM 20544                                    AEMIGKTHAHLCRDID−−−−−−−GYI−−−−−−−−−AVMSQ−−−NPK−−−−−−LD−−−SDKF−−−−FIKQ−−−−TYTA−−−−−GT−−−−−−−−−G−−−KQ−−−−−−YKRYDIT−−−−KMGCEMVANKLTG−−QKGIMFTAKYVEIFNKMAE−−−−−−−−−QIIEER−−−−−−−−−−−−TDSYMITD−−−−−−−PVKRAK−−−−−−K−−−−−WIEEETE−−−−RQKLRAENKEM−−−LP−−−−−−−KAQ                                                                                                                   
fig|330397.2.peg.72   Siphoviridae Listeria phage B054     NLAVLDKNNT−−−−−−LN−−−−−−−−SREVAEMVEKRHSDLLRDIE−−−−−−−TYI−−−−−−−−−RYINQ−−−NAK−−−−−−LR−−−SDDF−−−−FSES−−−−TYHA−−−−−GT−−−−−−−−−G−−−KE−−−−−−YKCYEIT−−−−KMGCEMIANKLTG−−AKGIQFTALFVQKFNKLEE−−−−−−−−−−−KEKQ−−−−−−−−−−−−TFYIPGT−−−−−−−YAEALT−−−−−−L−−−−−AAKQAEL−−−−NEQLMLENEVK−−−TQ−−−−−−−T                                                                                                                     
fig|272626.1.peg.1250   Listeria innocua Clip11262     NLAVLDKNNT−−−−−−LN−−−−−−−−SREVAEMVEKRHSDLLRDIE−−−−−−−TYI−−−−−−−−−RYINQ−−−NAK−−−−−−LR−−−SDDF−−−−FSES−−−−TYQA−−−−−GT−−−−−−−−−G−−−KD−−−−−−YKCYEIT−−−−KMGCEMIANKLTG−−AKGIQFTALFVQKFNKLEE−−−−−−−−−−−KEMQ−−−−−−−−−−−−TFYIPGT−−−−−−−YAEALT−−−−−−L−−−−−AAKQAEL−−−−NEQLMLENEVK−−−TQ−−−−−−−T                                                                                                                     
fig|272626.1.peg.1727   Listeria innocua Clip11262     NLAVLDKNNT−−−−−−LN−−−−−−−−SREVAEMVEKRHSDLLRDIE−−−−−−−TYI−−−−−−−−−RYINQ−−−NAK−−−−−−LR−−−SDDF−−−−FSES−−−−TYQA−−−−−GT−−−−−−−−−G−−−KD−−−−−−YKCYEIT−−−−KMGCEMIANKLTG−−AKGIQFTALFVQKFNKLEE−−−−−−−−−−−KEMQ−−−−−−−−−−−−TFYIPGT−−−−−−−YAEALT−−−−−−L−−−−−AAKQAEL−−−−NEQLMLENEVK−−−TQ−−−−−−−T                                                                                                                     
fig|457405.10.peg.1953   Fusobacterium nucleatum subsp. animalis 7_1            NGSY−−−−−VVS−−−−−−−−SRIIANQLGKRHDSVLRDID−−−−−−−KLI−−−−−−−−−−−−−−−−SSKLNIFKSPQF−−−CGDLKKSIFPNT−−−−−−YKD−−−−−SK−−−−−−−−−−−−−NRN−−−−−YREYLLT−−−−KDGFTLYMFNIQG−−−−YNDFKMAYINEFNKMER−−−−−−−−−ELKNKKQRVLPFS−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NTMMIPIDKAKYWTKIKNLSDKAENIRKEVYRKLNLLSNMSVLITDEIDKLSNIVFETEDCINKI                                                                                       
fig|458233.11.peg.1059   Macrococcus caseolyticus JCSC5402         IENNSEL−−−GPVVS−−−−−−−−SRIVAEELSRRHSHVIRDLE−−−−−−−KILLDP−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−NVGSVIFESKYKD−−−−−VT−−−−−−−−−−−−−GRT−−−−−LKEYLLT−−−−KDGFILYMFNIQG−−−−HNDFKMAYINRFNEMEK−−−−−−−−−TLQNRLPGTYKEALLQ−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LVEQVEENEKLHLENTMQKQQ                                                                                                                                   
fig|556263.3.peg.2011   Fusobacterium sp. D12        VENKDGIL−−−−−VVS−−−−−−−−SNRVAVELGIRHDNLLNKID−−−−−−−DYV−−−−−−−−−−−−−−−−−−−−KKFNSPKL−−−SGQF−−−−YISS−−−−NYKD−−−−−KS−−−−−−−−−−−−−GKS−−−−−NRNYLIT−−−−KKGIAQIIGGYSAAVPKAFEYNVAYINEFERMEQ−−−−−−−−−ILRNRNSSEWLLTRE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−QGKLIRRVETD−−−−−−−−−−−−AIQELIPYAKEQGS                                                                                                        
fig|469616.3.peg.1863   Fusobacterium mortiferum ATCC 9817     NVVVEKVDGIL−−−VTT−−−−−−−−SNRVAEELGVLHKDLLEKID−−−−−−−NYV−−−−−−−−−−−−−−−−−GKFTKAESSAL−−−IKEF−−−−YIPS−−−−YYKVN−−−−−GN−−−−−−−−−−−−−FRT−−−−−YRNYLIT−−−−KKGIAQLIGGYSSAVEKAFDLNVAYINRFEEMEK−−−−−−−−−LIYHQEFIENRE−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−LLTKIQKLENE−−−−−−−−−−−−−−LNQIPMTWSQVEVVKEQITETVLRR−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−−MKSTGISNRTFKLRLKKELVKDIQSRFGIDSLVELKYKDYLTVMPYIFNW      
fig|526998.3.peg.4559   Bacillus mycoides Rock1-4     SLRVINRGGKL−−−LVD−−−−−−−−SREVANMIGKRHTDLLRSIE−−−−−−−NYI−−−−−−−−−KILENA−−−−−−−−−−KMR−−−SQNF−−−−FVED−−−−NYTTE−−−−−GN−−−−−−−−−N−−−KA−−−−−−YKKYLLT−−−−RKGCDLVANKLTG−−EKGVLFTATYVMQFEEMEK−−−−−−−−−RIQGEQ−−−−−−−−−−−−K−−−MLGN−−−−−−−TYSQIK−−−−−−L−−−−−LATGTLD−−−−LNNRVTSLEEK−−−IE−−−−−−−−−−TQLTIDYGRQRI−−−−LEKSKAKR−−−−−−−−−−−−−−−−−−−−−−−−IYFLWENE−−−−HVDRKVHDSTRKLFGLLGRNLKDAFNVNSYRDILKKDFEEALNFINGWRPMV  
fig|526982.3.peg.4871   Bacillus cereus Rock1-15     SLRVVNQSGKL−−−LVD−−−−−−−−SREVANMIGKRHTDLLRSIE−−−−−−−NYI−−−−−−−−−QILENA−−−−−−−−−−KMR−−−SQDF−−−−FVED−−−−NYTTE−−−−−GN−−−−−−−−−N−−−KA−−−−−−YKKYLLT−−−−RKGCDLVANKLNG−−EKGVLFTATYVTQFEEMEK−−−−−−−−−RMQGEQ−−−−−−−−−−−−E−−−MLGN−−−−−−−TYNQIK−−−−−−L−−−−−LATGTID−−−−LNNRVTSLEEK−−−IE−−−−−−−−−−TQLTIDYGQQRI−−−−LEKSKAKR−−−−−−−−−−−−−−−−−−−−−−−−IYFLWGNE−−−−HVDREVHDSTRKLFGLLGRNLKDAFNVNSYRDILKKDFEEALNFINGWRPMV  
fig|527019.3.peg.1081   Bacillus thuringiensis IBL 200         TPVNEQA−−−−−TLS−−−−−−−−SLEVAKMVGKRHDNLMADIK−−−−−−−THI−−−−−−−−−GYLSEDDAL−−−−−−−KSQ−−−VVEY−−−−FRQS−−−−TYLD−−−−−KK−−−−−−−−−N−−−EA−−−−−−RPCYNIT−−−−KKGCELIAHKMTG−−KKGTLFSASYIERFHQMEQ−−−−−−−−−HIKKQN−−−−−−−−−−−−E−−−IPTD−−−−−−−PFKQIE−−−−−−L−−−−−IAAGTTN−−−−LNNRVSKLEHV−−−IE−−−−−−−−−−EQLTIDFGQQRV−−−−IEKAKGRR−−−−−−−−−−−−−−−−−−−−−−−−IYFLWEHG−−−−HVDKEVHGTTRKLFGLLGKNLKDAFDVNSYRDILKKDFDEALKFIEGWRPMI  
fig|527031.3.peg.2125   Bacillus thuringiensis serovar berliner ATCC 10792            NEQP−−−−−TLP−−−−−−−−SLEVAKMVGKEHKELLRDIR−−−−−−−TYI−−−−−−−−−SYLDGEEMSA−−−−−−KLR−−−PTNY−−−−FIES−−−−SYKD−−−−−SL−−−−−−−−−N−−−RK−−−−−−KLCYNIT−−−−KKGCELIAHKMTG−−KKGTLFSASYIERFHQMEQ−−−−−−−−−HIKKQN−−−−−−−−−−−−E−−−IPTD−−−−−−−PFGQIE−−−−−−L−−−−−IAAGATN−−−−LNNRVSKLEHV−−−IE−−−−−−−−−−EQLTIDFGQQRV−−−−IEKAKGRR−−−−−−−−−−−−−−−−−−−−−−−−IYFLWEHG−−−−HVDKEVHGTTRKLFGLLGKNLKDAFDVNSYRDILKKDFDEALKFIEGWRPMI  
fig|212045.4.peg.2262   Bacillus anthracis str. Western North America USA6153     ESLVFIKDNKV−−−VTD−−−−−−−−SLTVAEVLKKQHKHVLRDIK−−−−−−−VQM−−−−−−−−−EKLESAGE−−−−−−−−GEF−−−TESN−−−−FGLS−−−−FYKD−−−−−VT−−−−−−−−−G−−−RT−−−−−−LQKIDMT−−−−EDAFTILMFSYNT−−IETMKIKVRFIEEFKRMRA−−−−−−−−−FIENQS−−−−−−−−−−−−I−−−LPTD−−−−−−−TFSQIE−−−−−−L−−−−−LATGTSN−−−−LNKRVSSLEQV−−−VE−−−−−−−−−−KQLTVDYGQQRV−−−−IEKTKAKR−−−−−−−−−−−−−−−−−−−−−−−−IYFLWENG−−−−HVDSEVHDSTRKLFGLLGRNLKDAFNVNSYRDILKKDFEEALNFINGWRPMI  
fig|260799.1.peg.3506   Bacillus anthracis str. Sterne     ESLVFIKDNKV−−−VTD−−−−−−−−SLTVAEVLKKQHKHVLRDIK−−−−−−−VQM−−−−−−−−−EKLESAGE−−−−−−−−GEF−−−TESN−−−−FGLS−−−−FYKD−−−−−VT−−−−−−−−−G−−−RT−−−−−−LQKIDMT−−−−EDAFTILMFSYNT−−IETMKIKVRFIEEFKRMRA−−−−−−−−−FIENQS−−−−−−−−−−−−I−−−LPTD−−−−−−−TFSQIE−−−−−−L−−−−−LATGTSN−−−−LNKRVSSLEQV−−−VE−−−−−−−−−−KQLTVDYGQQRV−−−−IEKTKAKR−−−−−−−−−−−−−−−−−−−−−−−−IYFLWENG−−−−HVDSEVHDSTRKLFGLLGRNLKDAFNVNSYRDILKKDFEEALNFINGWRPMI  
fig|486622.3.peg.2726   Bacillus anthracis str. A0174     ESLVFIKDNKV−−−VTD−−−−−−−−SLTVAEVLKKQHKHVLRDIK−−−−−−−VQM−−−−−−−−−EKLESAGE−−−−−−−−GEF−−−TESN−−−−FGLS−−−−FYKD−−−−−VT−−−−−−−−−G−−−RT−−−−−−LQKIDMT−−−−EDAFTILMFSYNT−−IETMKIKVRFIEEFKRMRA−−−−−−−−−FIENQS−−−−−−−−−−−−I−−−LPTD−−−−−−−TFSQIE−−−−−−L−−−−−LATGTSN−−−−LNKRVSSLEQV−−−VE−−−−−−−−−−KQLTVDYGQQRV−−−−IEKTKAKR−−−−−−−−−−−−−−−−−−−−−−−−IYFLWENG−−−−HVDSEVHDSTRKLFGLLGRNLKDAFNVNSYRDILKKDFEEALNFINGWRPMI  
fig|280355.3.peg.272   Bacillus anthracis str. A1055     ESLVFIKDNKV−−−VTD−−−−−−−−SLTVAEVLKKQHKHVLRDIK−−−−−−−VQM−−−−−−−−−EKLESAGE−−−−−−−−GEF−−−TESN−−−−FGLS−−−−FYKD−−−−−VT−−−−−−−−−G−−−RT−−−−−−LQKIDMT−−−−EDAFTILMFSYNT−−IETMKIKVRFIEEFKRMRA−−−−−−−−−FIENQS−−−−−−−−−−−−I−−−LPTD−−−−−−−TFSQIE−−−−−−L−−−−−LATGTSN−−−−LNKRVSSLEQV−−−VE−−−−−−−−−−KQLTVDYGQQRV−−−−IEKTKAKR−−−−−−−−−−−−−−−−−−−−−−−−IYFLWENG−−−−HVDSEVHDSTRKLFGLLGRNLKDAFNVNSYRDILKKDFEEALNFINGWRPMI  
fig|315730.5.peg.4018   Bacillus weihenstephanensis KBAB4     NVLVFENDGQV−−−VTD−−−−−−−−SLTIAEMFEKEHKHVVRDIE−−−−−−−VQL−−−−−−−−−EKLKEAGE−−W