The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93062.4.peg.795: Staphylococcus aureus subsp. aureus COL

This feature in The SEED Viewer

NCBI Taxonomy Id: 93062

Current Assignment: Hypothetical protein, PVL orf39 homolog [SA bacteriophages 11, Mu50B]
Translate Function Assignments



Context on contig NC_002951 from base 354674 to 398267 (43594 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
780 358076 357357 720 -       1: 1 cwn
ff
Phage repressor protein cI GeneID:3236915, LocusTag:SACOL0321, YP_185213.1, gi|57651248
781 358218 358436 219 + 141     1: 1 ff Cro-like repressor [SA bacteriophages 11, Mu50B] GeneID:3236916, LocusTag:SACOL0322, YP_185214.1, gi|57651249
782 358451 358759 309 + 14       ff Phage protein GeneID:3236937, LocusTag:SACOL0323, YP_185215.1, gi|57651250
783 358915 358763 153 - 3         hypothetical protein GeneID:3236938, LocusTag:SACOL0324, YP_185216.1, gi|57651251
784 358916 359707 792 + 0     2: 1 2 ff Phage antirepressor protein GeneID:3236939, LocusTag:SACOL0325, YP_185217.1, gi|57651252
785 359708 359932 225 + 0     1: 1 ff Phage phi 11 orf8 protein homolog GeneID:3236940, LocusTag:SACOL0326, YP_185218.1, gi|57651253
786 359972 360217 246 + 39       ff Phage protein GeneID:3236941, LocusTag:SACOL0327, YP_185219.1, gi|57651254
787 360551 360186 366 - -32       ff Phage protein GeneID:3236942, LocusTag:SACOL0328, YP_185220.1, gi|57651255
788 360605 360805 201 + 53       ff hypothetical protein within prophage GeneID:3236932, LocusTag:SACOL0329, YP_185221.1, gi|57651256
789 361172 360792 381 - -14       ff FIG01108733: hypothetical protein GeneID:3236933, LocusTag:SACOL0330, YP_185222.1, gi|57651257
790 361220 361411 192 + 47         ORF037 GeneID:3236934, LocusTag:SACOL0331, YP_185223.1, gi|57651258
791 361640 361389 252 - -23         FIG01110270: hypothetical protein GeneID:3236935, LocusTag:SACOL0332, YP_185224.1, gi|57651259
792 361695 361958 264 + 54       ff hypothetical protein within a prophage GeneID:3236936, LocusTag:SACOL0333, YP_185225.1, gi|57651260
793 361971 362132 162 + 12       ff Phage phi 11 orf10a protein homolog GeneID:3236896, LocusTag:SACOL0334, YP_185226.1, gi|57651261
794 362222 362539 318 + 89       ff ORF045 GeneID:3236897, LocusTag:SACOL0335, YP_185227.1, gi|57651262
795 362544 362804 261 + 4   1: 1 ff Hypothetical protein, PVL orf39 homolog [SA bacteriophages 11, Mu50B] GeneID:3236898, LocusTag:SACOL0336, YP_185228.1, gi|57651263
796 362814 363035 222 + 9     1: 1 ff Phage phi-ETA orf16 protein homolog GeneID:3236899, LocusTag:SACOL0337, YP_185229.1, gi|57651264
797 363028 363651 624 + -8     1: 2 ff Phage protein GeneID:3236900, LocusTag:SACOL0338, YP_185230.1, gi|57651265
798 363651 364070 420 + -1     4: 2 4 3 5 cwn
ff
Single-stranded DNA-binding protein GENE:ssb1, GeneID:3236901, LocusTag:SACOL0339, YP_185231.1, gi|57651266, ssb1
799 364084 364779 696 + 13 4 1: 1 ff Hypothetical protein, PV83 orf19 homolog [SA bacteriophages 11, Mu50B] GeneID:3236902, LocusTag:SACOL0340, YP_185232.1, gi|57651267
800 364751 365551 801 + -29     1: 1 ff Phage replication initiation GeneID:3236903, LocusTag:SACOL0341, YP_185233.1, gi|57651268
801 365551 365907 357 + -1     2: 1 2 ff Phage protein GeneID:3236904, LocusTag:SACOL0342, YP_185234.1, gi|57651269
802 365904 367145 1242 + -4     1: 1 cwn
ff
DNA helicase, phage-associated GeneID:3236905, LocusTag:SACOL0343, YP_185235.1, gi|57651270
803 367142 367357 216 + -4       ff Phage protein GeneID:3236906, LocusTag:SACOL0344, YP_185236.1, gi|57651271
804 367360 367581 222 + 2     1: 1 ff Phage phi 11 orf17 protein homolog GeneID:3236907, LocusTag:SACOL0345, YP_185237.1, gi|57651272
805 367591 368016 426 + 9         Phage DNA modification methyltransferase GeneID:3236908, LocusTag:SACOL0346, YP_185238.1, gi|57651273
pp.1 354674 398267 43594 + -13343         Prophage 1. Evidence: 18 nt repeat confirmed by Ramy; attL: fig|93062.4.att.1; attR: fig|93062.4.att.2  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Staphylococcal_phi-Mu50B-like_prophages SvetaG Hypothetical protein, PVL orf39 homolog [SA bacteriophages 11, Mu50B]


  Protein Sequence

>fig|93062.4.peg.795 Hypothetical protein, PVL orf39 homolog [SA bacteriophages 11, Mu50B]
MYYKAGEIKNKIINFNGFEFKVSAMKRHDGISIQVKDMNNVPLKSFHVVDLSELYIAMDA
MHDVINEWIEENTDEQDRLINLVMKW

MD5 = a04523f46da5e866affe7cf53d4bfebf


  DNA Sequence

>fig|93062.4.peg.795 Hypothetical protein, PVL orf39 homolog [SA bacteriophages 11, Mu50B]
atgtattacaaagcgggtgagataaaaaataaaattataaactttaacgggttcgaattt
aaagtgtctgcgatgaagagacatgacggtatcagtatacaagttaaggatatgaataat
gttccacttaaatcatttcatgtcgtagatttaagcgaactatatattgcaatggatgca
atgcacgacgttataaacgaatggattgaagagaacacagatgaacaggacagactaatt
aacttagtcatgaaatggtag


  DNA with Flanking Sequence

>fig|93062.4.peg.795 Hypothetical protein, PVL orf39 homolog [SA bacteriophages 11, Mu50B]
ttctatacttcactacagcatggtcaattgcgggattcgcaagtatcgcaacattcatat
tttataaagaatacttttatgaagaataaaaaaactgctacttgcgccaacaagtaacag
taagtgttcatcaaaatatacaacttaattaaatcaaaatatacggaggtagtcaactat
ggctaaaaatattaaaacagaacaacattattacactaaagatttctcaggatacagaaa
tgaagaagataattttgtagcaaatcaagaattgacagtaacaatcacattgaacgagta
cagaaaacttattgaaataaaggctgttaaagataaagaagaagatacttacctctgtaa
gtattttgcggaagaaagaaaaaacgaaaaattggaaaaagaaaatataaaactgaaaaa
caaaatttatgaattacaaaacgaagaagataacgaggagtgcgaagaggagtacgaaga
atacaaggaggactaaaacaatgtattacaaagcgggtgagataaaaaataaaattataa
actttaacgggttcgaatttaaagtgtctgcgatgaagagacatgacggtatcagtatac
aagttaaggatatgaataatgttccacttaaatcatttcatgtcgtagatttaagcgaac
tatatattgcaatggatgcaatgcacgacgttataaacgaatggattgaagagaacacag
atgaacaggacagactaattaacttagtcatgaaatggtaggaggtcgctatgaagcaga
ctgtaacttatatcattcgtcatagggatatgccaatttatataactaacaaaccaactg
ataacaattcagatattagttactccacaaatagaaatagagctagggagtttaacggta
tggaagaagcgagtatcaatatggattatcacaaagcaatcaagaaaacagtgacagaaa
caattgagtacgaggaggtagaacatgactgaacaaacattatttgaacagttgaacagt
aaaaacgtgaatgatcatacagaacaaaaaaatggattaacttatctagcatggtcatat
gcacaccaagagctgaaaaagattgacccaaactacacagtaaaagtacacgagtttcca
catccagatattaacacagaaaattattttgtaccttatttggctacaccagaaggctat
tttgtacaggtatctgtgactgtgaaagatagtacagagactgagtggcttccagtattg
g


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|SACOL0336 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
fig|445517.2.peg.13 Viruses Staphylococcus phage tp310-3 Viruses. FIG   Hypothetical protein, PVL orf39 homolog [SA bacteriophages 11, Mu50B]
fig|648017.2.peg.15 Viruses Staphylococcus phage phiPVL-CN125 Viruses. FIG   Hypothetical protein, PVL orf39 homolog [SA bacteriophages 11, Mu50B]
gb|AAW37543.1 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
gb|ABS87542.1 Staphylococcus phage tp310-3     hypothetical protein
gb|ACR54201.1 Staphylococcus phage phiPVL-CN125     hypothetical protein CUR012
gi|154818116 Staphylococcus phage tp310-3 NCBI   hypothetical protein
gi|156604030 Staphylococcus phage tp310-3 NCBI   hypothetical protein SPTP3103_gp13
gi|238683998 Staphylococcus phage phiPVL-CN125 NCBI   hypothetical protein CUR012
gi|239507373 Staphylococcus phage phiPVL-CN125 NCBI   hypothetical protein CUR012
gi|57285449 Staphylococcus aureus subsp. aureus COL NCBI   conserved hypothetical protein
gi|57651263 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL0336
img|637151111 Staphylococcus aureus aureus COL IMG   hypothetical protein
img|641210052 Staphylococcus phage tp310-3 provirus IMG   hypothetical protein
kegg|sac:SACOL0336 Staphylococcus aureus subsp. aureus COL KEGG   hypothetical protein
ref|YP_001429975.1 Staphylococcus phage tp310-3 RefSeq   hypothetical protein SPTP3103_gp13
ref|YP_002939683.1 Staphylococcus phage phiPVL-CN125 RefSeq   hypothetical protein CUR012
ref|YP_185228.1 Staphylococcus aureus subsp. aureus COL RefSeq   hypothetical protein SACOL0336
tr|A7TWM5 Staphylococcus phage tp310-3 TrEMBL   Putative uncharacterized protein
tr|C5I636 Staphylococcus phage phiPVL-CN125 TrEMBL   Putative uncharacterized protein
tr|Q5HJ29 Staphylococcus aureus (strain COL) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
4 fig|93062.4.peg.799 Hypothetical protein, PV83 orf19 homolog [SA bacteriophages 11, Mu50B]


  Attributes

Help on Attributes

Key
Link Explains Key
Value
CELLO::cytoplasm 3.846
evidence_code ff
isoelectric_point 5.09
molecular_weight 10164
PFAM::PF06531 938.690;1-86
PSORT::Cytoplasmic 8.87
PSORT_score::Cytoplasmic 8.87
similar_to_human no


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search