The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93062.4.peg.777: Staphylococcus aureus subsp. aureus COL

This feature in The SEED Viewer

NCBI Taxonomy Id: 93062

Current Assignment: Phage integrase
Translate Function Assignments



Context on contig NC_002951 from base 349294 to 398267 (48974 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
773 350094 349294 801 -       1: 2 ff
icw(4)
isu
Sialic acid utilization regulator, RpiR family GeneID:3236928, LocusTag:SACOL0314, YP_185206.1, gi|57651241
774 350234 350902 669 + 139     2: 2 5 ff
icw(4)
isu
N-acetylmannosamine-6-phosphate 2-epimerase (EC 5.1.3.9) GeneID:3236929, LocusTag:SACOL0315, YP_185207.1, gi|57651242
775 352342 351029 1314 - 126       ff Predicted histidine uptake transporter GeneID:3236930, LocusTag:SACOL0316, YP_185208.1, gi|57651243
776 352760 354694 1935 + 417       ff Triacylglycerol lipase (EC 3.1.1.3) GeneID:3236931, LocusTag:SACOL0317, YP_185209.1, gi|57651244
att.1 354674 354691 18 + -21         attL for fig|93062.4.pp.1  
777 355990 354785 1206 - 93   1: 1 cwn Phage integrase GENE:int, GeneID:3236912, LocusTag:SACOL0318, YP_185210.1, gi|57651245, int
778 356897 356184 714 - 193     1: 3 ff
isu
Hypothetical SAR0365 homolog in superantigen-encoding pathogenicity islands SaPI GeneID:3236913, LocusTag:SACOL0319, YP_185211.1, gi|57651246
779 357202 356975 228 - 77         hypothetical protein within prophage GeneID:3236914, LocusTag:SACOL0320, YP_185212.1, gi|57651247
780 358076 357357 720 - 154 7 1: 1 cwn
ff
Phage repressor protein cI GeneID:3236915, LocusTag:SACOL0321, YP_185213.1, gi|57651248
781 358218 358436 219 + 141     1: 1 ff Cro-like repressor [SA bacteriophages 11, Mu50B] GeneID:3236916, LocusTag:SACOL0322, YP_185214.1, gi|57651249
782 358451 358759 309 + 14       ff Phage protein GeneID:3236937, LocusTag:SACOL0323, YP_185215.1, gi|57651250
783 358915 358763 153 - 3         hypothetical protein GeneID:3236938, LocusTag:SACOL0324, YP_185216.1, gi|57651251
784 358916 359707 792 + 0     2: 1 4 ff Phage antirepressor protein GeneID:3236939, LocusTag:SACOL0325, YP_185217.1, gi|57651252
785 359708 359932 225 + 0     1: 1 ff Phage phi 11 orf8 protein homolog GeneID:3236940, LocusTag:SACOL0326, YP_185218.1, gi|57651253
786 359972 360217 246 + 39       ff Phage protein GeneID:3236941, LocusTag:SACOL0327, YP_185219.1, gi|57651254
787 360551 360186 366 - -32       ff Phage protein GeneID:3236942, LocusTag:SACOL0328, YP_185220.1, gi|57651255
788 360605 360805 201 + 53       ff hypothetical protein within prophage GeneID:3236932, LocusTag:SACOL0329, YP_185221.1, gi|57651256
789 361172 360792 381 - -14       ff FIG01108733: hypothetical protein GeneID:3236933, LocusTag:SACOL0330, YP_185222.1, gi|57651257
pp.1 354674 398267 43594 + -6499         Prophage 1. Evidence: 18 nt repeat confirmed by Ramy; attL: fig|93062.4.att.1; attR: fig|93062.4.att.2  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Staphylococcal_phi-Mu50B-like_prophages SvetaG Integrase [SA bacteriophages 11, Mu50B]


  Protein Sequence

>fig|93062.4.peg.777 Phage integrase
MWFEKFKNKNNETKYRYYEKYKDPYTDKWKRVSVVLNKNTKQSQKEAMFRLEEKIKEKLN
NKSSSELKTLTFHALLDEWLEYHIKTSGFKVTTLDNLKTRIKNIKKNSSQNLLLNKIDTK
YMQTFINELSNVYSANQVKRQLGHMKEAIKYAVKFYNYPNEHILNSVTLPKKSKTIEDIE
KEEAKMYNYLEMEQVIQIRDFILNDNNMQYRARILVAGAVEVQALTGMRIGELLALQVKD
VDLKNKTIDINGTIHRIKCNAGFGHKDTTKTAGSKRKIAINSRIANVLKKIMLENKKMQQ
WEPSYVDRGFIFTTCQGNPMQGSRINKRLSSAAESLNINKKVTTHTLRHTHISLLAEMNI
SLKAIMKRVGHTDEKTTIKVYTHVTEKMDRELEQKLEKLVY

MD5 = 50a945cfeb9e175a3868a1f63a68cc00


  DNA Sequence

>fig|93062.4.peg.777 Phage integrase
atgtggtttgaaaaatttaaaaataagaacaatgaaacgaagtatagatactacgagaaa
tacaaagatccgtatacagataaatggaaacgtgtaagtgttgtcttgaataagaataca
aagcaatcgcaaaaagaggcaatgtttcgtttagaagaaaaaataaaagaaaaactaaac
aacaagtcgtcaagcgaattaaaaactttgacttttcacgcgttattagatgaatggctt
gaatatcatataaaaacatctggctttaaagtaacgacgcttgataatttgaaaacaaga
atcaaaaacatcaaaaagaacagttctcaaaatttacttttaaacaaaattgatacaaag
tacatgcaaacatttattaacgaattatcaaacgtatattctgcaaatcaggtaaagcgt
caacttggacatatgaaagaagctattaaatacgccgttaaattttacaattatccaaac
gaacacatattaaatagcgtcacactaccaaagaagagtaagacgatagaagatatagaa
aaagaagaagcgaaaatgtacaactatttagagatggaacaggtaatacagatacgcgat
tttatactgaacgataataacatgcagtatagagctcgtattttagttgctggggctgta
gaagttcaagctttaacaggtatgcgcataggtgagttattagctctccaagttaaagat
gttgacctcaaaaataaaacgatcgatattaatggcactattcacagaatcaaatgtaat
gctggatttggtcacaaagatactacgaagaccgcaggttcaaaaagaaaaatcgccatc
aattcaaggatagcaaatgtattgaaaaaaataatgttagaaaataaaaagatgcaacaa
tgggaaccaagctatgttgatagagggtttatattcacaacttgccaaggaaatcctatg
caaggcagtaggataaacaaacgattgtcctcagctgcagaatcattaaatataaataaa
aaagttactactcacacactaaggcatacacacataagtttattggcggaaatgaatata
tcgttaaaagcaattatgaaaagagtaggacatacagatgaaaaaacgactataaaggta
tatacccatgtaacagagaaaatggacagagagttagagcaaaaattagaaaaacttgtg
tactaa


  DNA with Flanking Sequence

>fig|93062.4.peg.777 Phage integrase
aaaaaacaacacagaattcatcactaaagattattttagtgaatttatatctgatagttt
agaaattgaaaataaattaaataaaattgacagaaacattaataacatagtatcagcaat
tgataaggtaaaaaaattaaaaggtaatagttacgcttgcataaattctttccagccgat
tagtaagtttcgcataagaaaagttttacccccaaaaattaaaaatccagtaatagattc
ttcggatattatgttactgataaatagaattaataataatatattgcagattcctgatat
aagatgatataattttaatatattaaaggtttatcctttaaaacacgtatatattcgtta
ccatttttggtaattaaccatgtaatcttataactataagtggcgtctgtattttataca
ggcgtctttttttatacaattttcatgggtagcccgcctacccttattatttttttgcca
attttgaggagggatgtaaaatgtggtttgaaaaatttaaaaataagaacaatgaaacga
agtatagatactacgagaaatacaaagatccgtatacagataaatggaaacgtgtaagtg
ttgtcttgaataagaatacaaagcaatcgcaaaaagaggcaatgtttcgtttagaagaaa
aaataaaagaaaaactaaacaacaagtcgtcaagcgaattaaaaactttgacttttcacg
cgttattagatgaatggcttgaatatcatataaaaacatctggctttaaagtaacgacgc
ttgataatttgaaaacaagaatcaaaaacatcaaaaagaacagttctcaaaatttacttt
taaacaaaattgatacaaagtacatgcaaacatttattaacgaattatcaaacgtatatt
ctgcaaatcaggtaaagcgtcaacttggacatatgaaagaagctattaaatacgccgtta
aattttacaattatccaaacgaacacatattaaatagcgtcacactaccaaagaagagta
agacgatagaagatatagaaaaagaagaagcgaaaatgtacaactatttagagatggaac
aggtaatacagatacgcgattttatactgaacgataataacatgcagtatagagctcgta
ttttagttgctggggctgtagaagttcaagctttaacaggtatgcgcataggtgagttat
tagctctccaagttaaagatgttgacctcaaaaataaaacgatcgatattaatggcacta
ttcacagaatcaaatgtaatgctggatttggtcacaaagatactacgaagaccgcaggtt
caaaaagaaaaatcgccatcaattcaaggatagcaaatgtattgaaaaaaataatgttag
aaaataaaaagatgcaacaatgggaaccaagctatgttgatagagggtttatattcacaa
cttgccaaggaaatcctatgcaaggcagtaggataaacaaacgattgtcctcagctgcag
aatcattaaatataaataaaaaagttactactcacacactaaggcatacacacataagtt
tattggcggaaatgaatatatcgttaaaagcaattatgaaaagagtaggacatacagatg
aaaaaacgactataaaggtatatacccatgtaacagagaaaatggacagagagttagagc
aaaaattagaaaaacttgtgtactaaaaggtatctgccctttttctgcccttttttattt
ttaaagacgctacaaatcctttgtaacaactgatattaaaggctttttaacacaagttaa
tcccatccttgtatgattggtttaacttgccagatacctctgcgtgtggcaggttcatca
ttcgtaacattaacaaatggttgattggacggatgtaatgacgaaatcactggtacgaca
ccatcatttttacgccattcttctcttgcatcatgaccaataattctactcgttgtagcc
attaagaaaaatgtacctaaatcaggattttcataacctaatggaccagtatgagatgat
acacctgtataagtcgtatacgtaatattaggattcatacttgtcatgttgttcaatttt
gcagagccatctaacgttaaatcataggcagcattgtcgtctgatgtccaaattttgctt
ttactaacgcgttttatatagtcaatgtaactctcatttggtaatt


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003677       F:DNA binding
GO:0006310       P:DNA recombination
GO:0015074       P:DNA integration
cmr|SACOL0318 Staphylococcus aureus subsp. aureus COL     prophage L54a, integrase
fig|452948.4.peg.2271 Staphylococcus aureus 930918-3 FIG   Phage integrase
fig|93062.19.peg.311 Staphylococcus aureus subsp. aureus COL FIG   Phage integrase
gb|AAW37525.1 Staphylococcus aureus subsp. aureus COL     prophage L54a, integrase
gb|EEW44188.1 Staphylococcus aureus 930918-3     prophage L54a, integrase
gi|259159122 Staphylococcus aureus 930918-3 NCBI   prophage L54a, integrase
gi|57285431 Staphylococcus aureus subsp. aureus COL NCBI   prophage L54a, integrase
gi|57651245 Staphylococcus aureus subsp. aureus COL NCBI   prophage L54a, integrase
img|637151093 Staphylococcus aureus aureus COL IMG   prophage L54a, integrase
kegg|sac:SACOL0318 Staphylococcus aureus subsp. aureus COL KEGG   prophage L54a, integrase
ref|YP_185210.1 Staphylococcus aureus subsp. aureus COL RefSeq   prophage L54a, integrase
tr|Q5HJ47 Staphylococcus aureus (strain COL) TrEMBL   Prophage L54a, integrase


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
7 fig|93062.4.peg.780 Phage repressor protein cI


  Attributes

Help on Attributes

Key
Link Explains Key
Value
CDD::29510 968.100;188-388
CDD::29520 950.100;189-396
CDD::40675 977.100;190-391
CELLO::cytoplasm 2.254
evidence_code cwn
GO GO:0003677 DNA binding
GO GO:0006310 DNA recombination
GO GO:0015074 DNA integration
isoelectric_point 10.34
molecular_weight 46974
PFAM::PF00589 939.650;198-391
PSORT::Cytoplasmic 8.87
PSORT_score::Cytoplasmic 8.87
similar_to_human no


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search