The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93062.19.peg.1154: Staphylococcus aureus subsp. aureus COL

This feature in The SEED Viewer

NCBI Taxonomy Id: 93062

Current Assignment: FIG01108191: hypothetical protein
Translate Function Assignments



Context on contig NC_002951 from base 1179364 to 1190868 (11505 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1147 1179597 1179364 234 -           FIG01108519: hypothetical protein locus|SACOL1172, protein_id|YP_186035.1, gi|57650271, geneID|3238597
1148 1181033 1180074 960 - 476         Alpha-hemolysin precursor gene_name|hlY, locus|SACOL1173, protein_id|YP_186036.1, gi|57650272, geneID|3237999
1149 1181706 1181852 147 + 672         Doubtful CDS. No database matches locus|SACOL1174, protein_id|YP_186037.1, gi|57650273, geneID|3238304
1150 1181809 1182033 225 + -44         FIG01108126: hypothetical protein locus|SACOL1175, protein_id|YP_186038.1, gi|57650274, geneID|3238126
1151 1182242 1182421 180 + 208         hypothetical protein locus|SACOL1177, protein_id|YP_186040.1, gi|57650276, geneID|3238517
1152 1183306 1182590 717 - 168         FIG01107944: hypothetical protein locus|SACOL1178, protein_id|YP_186041.1, gi|57650277, geneID|3238464
1153 1184139 1183414 726 - 107         FIG01107880: hypothetical protein locus|SACOL1179, protein_id|YP_186042.1, gi|57650278, geneID|3238522
1154 1184959 1184234 726 - 94         FIG01108191: hypothetical protein locus|SACOL1180, protein_id|YP_186043.1, gi|57650279, geneID|3238179
1155 1185397 1186398 1002 + 437     4: 4 1 2 6   Ornithine carbamoyltransferase (EC 2.1.3.3) gene_name|arcB1, locus|SACOL1181, protein_id|YP_186044.1, gi|57650280, geneID|3238259
1156 1186421 1187353 933 + 22     3: 3 1 2   Carbamate kinase (EC 2.7.2.2) gene_name|arcC1, locus|SACOL1182, protein_id|YP_186045.1, gi|57650281, geneID|3238413
1157 1187525 1189081 1557 + 171     4: 3 1 2 5   Arginine/ornithine antiporter ArcD locus|SACOL1183, protein_id|YP_186046.1, gi|57650282, geneID|3238125
1158 1189389 1189616 228 + 307         FIG01108137: hypothetical protein  
1159 1190868 1189921 948 - 304         putative permease locus|SACOL1184, protein_id|YP_186047.1, gi|57650283, geneID|3238559

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93062.19.peg.1154 FIG01108191: hypothetical protein
MKKNIMNKLVLSTALLLLETTSTQLPKTPISFSSEAKAYNISENETNINELIKYYTQPHF
SLSGKWLWQKPNGSIHATLQTWVWYSHIQVFGSESWGNINQLRNKYVDIFGTKDEDTVEG
YWTYDETFTGGVTPAATSSDKPYRLFLKYSDKQQTIIGGHEFYKGNKPVLTLKELDFRIR
QTLIKNKKLYNGEFNKGQIKITADGNNYTIDLSKKLKLTDTNRYVKNPRNAEIEVILEKS
N

MD5 = c2d7626040bd6d8f5898415531c722a2


  DNA Sequence

>fig|93062.19.peg.1154 FIG01108191: hypothetical protein
atgaaaaagaacatcatgaataaattagttttatcaacagcattgttacttttagaaact
acatcaacacaacttcctaaaacaccaatcagtttttcatctgaagcaaaagcctataat
atcagtgaaaacgagactaatatcaatgaactaatcaaatattacactcagccgcatttt
tcattatctggaaaatggttatggcaaaagcccaatggtagcattcatgcaacattgcaa
acgtgggtttggtatagtcatattcaagtgtttggatccgagagttggggaaacattaat
cagttaagaaataaatacgttgatatatttggaactaaagatgaggacacagttgaaggt
tactggacttatgatgaaacatttactggtggtgttacgccagcagctacttcatctgat
aagccttatagactatttttaaaatatagtgataaacaacaaactatcatcggtggacat
gaattttacaaaggaaataaaccagtattaactttaaaagaattagatttccgtattcgt
caaacattaataaaaaataaaaagttatataacggagaatttaataaaggtcaaattaag
ataactgctgatggaaataattacacgattgatttaagtaaaaagttaaaattaactgac
acaaaccgttatgttaaaaatcctcgtaatgcagaaattgaagtcatactcgaaaaatct
aactaa


  DNA with Flanking Sequence

>fig|93062.19.peg.1154 FIG01108191: hypothetical protein
ttctacctcttgtcgtgaaaagtctaataaagttaaaaaacttctgtttcgtaaattttt
cattaataacaactccttttattttagttacacctaaattgtaagcgcatacaaaataaa
cacaacctactattaaaatttgtaatattttatcaataattaaatgaacattttattaat
attaaatttaagtagtaggaaataattaaaataagtactacatttaaagtataactattt
ttcaagtagttagaaaattcaattatcaaacaatttaatacaattgattagagaataatt
ctaacgtatcgtttttaatatataactcccgcctactttattagatactgtttctgtcca
aaacttaaaaatgataagttttgcttaaataacactactaactgtttaagtttatttaac
atagttttagcttttatttaattccgaatcggtgtaatagcttatatactttgggtaatt
cacgcaaaggagattttcatatgaaaaagaacatcatgaataaattagttttatcaacag
cattgttacttttagaaactacatcaacacaacttcctaaaacaccaatcagtttttcat
ctgaagcaaaagcctataatatcagtgaaaacgagactaatatcaatgaactaatcaaat
attacactcagccgcatttttcattatctggaaaatggttatggcaaaagcccaatggta
gcattcatgcaacattgcaaacgtgggtttggtatagtcatattcaagtgtttggatccg
agagttggggaaacattaatcagttaagaaataaatacgttgatatatttggaactaaag
atgaggacacagttgaaggttactggacttatgatgaaacatttactggtggtgttacgc
cagcagctacttcatctgataagccttatagactatttttaaaatatagtgataaacaac
aaactatcatcggtggacatgaattttacaaaggaaataaaccagtattaactttaaaag
aattagatttccgtattcgtcaaacattaataaaaaataaaaagttatataacggagaat
ttaataaaggtcaaattaagataactgctgatggaaataattacacgattgatttaagta
aaaagttaaaattaactgacacaaaccgttatgttaaaaatcctcgtaatgcagaaattg
aagtcatactcgaaaaatctaactaacctattaccttttgtaaatgcggataatttcaat
tatctaattaacccctttttataattaaacattccaacaatactcaaaggagaaattcga
atgaacaataacatcacgaaaaaaattattttatcaacaacattgttactattaggtaca
gcatctacacaatttcctaatacacctatcaattcttcatctgaagcgaaagcttattat
ataaatcaaaacgaaactaacgttaatgagttaactaaatattactcgcaaaaatattta
accttctctaacagtacgttatggcaaaaagataacggtacgattcatgcaacgttgtta
cagttttcttggtatagtcatattcaagtttatggacctgaaagttggggcaatatcaac
caattaagaaataaaagcgttgatatttttggcataaaagaccaagaaaccattgattct
tttgcattatctcaagaaacgtttactggtggtgttactcctgcag


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0005576       C:extracellular region
GO:0009405       P:pathogenesis
cmr|NT05SA1012 Staphylococcus aureus NCTC 8325     exotoxin
cmr|SACOL1180 Staphylococcus aureus subsp. aureus COL     exotoxin 3, putative
cmr|SAUSA300_1061 Staphylococcus aureus subsp. aureus USA300-FPR3757     putative exotoxin 3
dbj|BAF67349.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
fig|367830.3.peg.2490 Staphylococcus aureus subsp. aureus USA300 FIG   FIG01108191: hypothetical protein
fig|426430.6.peg.1046 Staphylococcus aureus subsp. aureus str. Newman FIG   FIG01108191: hypothetical protein
fig|426430.8.peg.1181 Staphylococcus aureus subsp. aureus str. Newman FIG   FIG01108191: hypothetical protein
fig|451515.3.peg.1169 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   FIG01108191: hypothetical protein
fig|451516.9.peg.1173 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   FIG01108191: hypothetical protein
fig|452948.4.peg.681 Staphylococcus aureus 930918-3 FIG   FIG01108191: hypothetical protein
fig|455227.3.peg.727 Staphylococcus aureus D30 FIG   FIG01108191: hypothetical protein
fig|553567.3.peg.1362 Staphylococcus aureus A5948 FIG   FIG01108191: hypothetical protein
fig|553590.4.peg.217 Staphylococcus aureus A9754 FIG   FIG01108191: hypothetical protein
fig|553594.3.peg.81 Staphylococcus aureus A9765 FIG   FIG01108191: hypothetical protein
fig|644279.4.peg.1179 Staphylococcus aureus subsp. aureus 132 FIG   FIG01108191: hypothetical protein
fig|93061.3.peg.1082 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   FIG01108191: hypothetical protein
fig|93061.5.peg.1034 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   FIG01108191: hypothetical protein
fig|93062.4.peg.1547 Staphylococcus aureus subsp. aureus COL FIG   FIG01108191: hypothetical protein
gb|AAW36559.1 Staphylococcus aureus subsp. aureus COL     exotoxin 3, putative
gb|ABD20603.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     putative exotoxin 3
gb|ABD30238.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABX29122.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     exotoxin
gb|EEV83299.1 Staphylococcus aureus A5948     superantigen-like protein
gb|EEW45463.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_1530
gb|EEW47760.1 Staphylococcus aureus D30     hypothetical protein SAD30_1574
gi|150374089 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|151221289 Staphylococcus aureus subsp. aureus str. Newman NCBI   superantigen-like protein
gi|160368151 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   exotoxin
gi|161509342 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   superantigen-like protein
gi|257860472 Staphylococcus aureus A5948 NCBI   superantigen-like protein
gi|258451864 Staphylococcus aureus A5948 NCBI   superantigen-like protein
gi|259160438 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_1530
gi|259163200 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_1574
gi|57284465 Staphylococcus aureus subsp. aureus COL NCBI   exotoxin 3, putative
gi|57650279 Staphylococcus aureus subsp. aureus COL NCBI   superantigen-like protein
gi|87126089 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   putative exotoxin 3
gi|87160115 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   superantigen-like protein
gi|87202428 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88194870 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   superantigen-like protein
img|637151942 Staphylococcus aureus aureus COL IMG   exotoxin 3, putative
img|637887713 Staphylococcus aureus aureus USA300 IMG   putative exotoxin 3
img|637893763 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|640795457 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|641309072 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   exotoxin
img|641771239 Staphylococcus aureus aureus USA300_TCH959 IMG   exotoxin
kegg|saa:SAUSA300_1061 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   superantigen-like protein
kegg|sac:SACOL1180 Staphylococcus aureus subsp. aureus COL KEGG   superantigen-like protein
kegg|sae:NWMN_1077 Staphylococcus aureus subsp. aureus Newman KEGG   superantigen-like protein
kegg|sao:SAOUHSC_01127 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   superantigen-like protein
kegg|sax:USA300HOU_1105 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   superantigen-like protein
ref|YP_001332111.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   superantigen-like protein
ref|YP_001575001.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   superantigen-like protein
ref|YP_186043.1 Staphylococcus aureus subsp. aureus COL RefSeq   superantigen-like protein
ref|YP_493759.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   superantigen-like protein
ref|YP_499670.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   superantigen-like protein
ref|ZP_05699885.1 Staphylococcus aureus A5948 RefSeq   superantigen-like protein
tr|A6QG67 Staphylococcus aureus (strain Newman) TrEMBL   Putative uncharacterized protein
tr|A8Z1U9 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Exotoxin
tr|Q2FHR9 Staphylococcus aureus (strain USA300) TrEMBL   Putative exotoxin 3
tr|Q2FZB1 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein
tr|Q5HGR4 Staphylococcus aureus (strain COL) TrEMBL   Exotoxin 3, putative


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search