The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93062.19.peg.1149: Staphylococcus aureus subsp. aureus COL

This feature in The SEED Viewer

NCBI Taxonomy Id: 93062

Current Assignment: Doubtful CDS. No database matches
Translate Function Assignments



Context on contig NC_002951 from base 1176734 to 1187353 (10620 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1140 1176734 1177231 498 +       1: 3   Extracellular fibrinogen-binding protein Efb gene_name|efb, locus|SACOL1168, protein_id|YP_186031.1, gi|57650267, geneID|3238454
1141 1177385 1177735 351 + 153         Involved in expression of fibrinogen binding protein locus|SACOL1169, protein_id|YP_186032.1, gi|57650268, geneID|3238697
1142 1178052 1178294 243 + 316         FIG01108361: hypothetical protein  
1144 1178322 1178432 111 + 27         hypothetical protein  
1145 1178742 1178557 186 - 124         FIG01107916: hypothetical protein locus|SACOL1171, protein_id|YP_186034.1, gi|57650270, geneID|3238139
1146 1179200 1178952 249 - 209         FIG01108338: hypothetical protein  
1147 1179597 1179364 234 - 163         FIG01108519: hypothetical protein locus|SACOL1172, protein_id|YP_186035.1, gi|57650271, geneID|3238597
1148 1181033 1180074 960 - 476         Alpha-hemolysin precursor gene_name|hlY, locus|SACOL1173, protein_id|YP_186036.1, gi|57650272, geneID|3237999
1149 1181706 1181852 147 + 672         Doubtful CDS. No database matches locus|SACOL1174, protein_id|YP_186037.1, gi|57650273, geneID|3238304
1150 1181809 1182033 225 + -44         FIG01108126: hypothetical protein locus|SACOL1175, protein_id|YP_186038.1, gi|57650274, geneID|3238126
1151 1182242 1182421 180 + 208         hypothetical protein locus|SACOL1177, protein_id|YP_186040.1, gi|57650276, geneID|3238517
1152 1183306 1182590 717 - 168         FIG01107944: hypothetical protein locus|SACOL1178, protein_id|YP_186041.1, gi|57650277, geneID|3238464
1153 1184139 1183414 726 - 107         FIG01107880: hypothetical protein locus|SACOL1179, protein_id|YP_186042.1, gi|57650278, geneID|3238522
1154 1184959 1184234 726 - 94         FIG01108191: hypothetical protein locus|SACOL1180, protein_id|YP_186043.1, gi|57650279, geneID|3238179
1155 1185397 1186398 1002 + 437     4: 4 1 2 6   Ornithine carbamoyltransferase (EC 2.1.3.3) gene_name|arcB1, locus|SACOL1181, protein_id|YP_186044.1, gi|57650280, geneID|3238259
1156 1186421 1187353 933 + 22     3: 5 1 2   Carbamate kinase (EC 2.7.2.2) gene_name|arcC1, locus|SACOL1182, protein_id|YP_186045.1, gi|57650281, geneID|3238413

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93062.19.peg.1149 Doubtful CDS. No database matches
MKLFYIVFLIIIWLNIFLGNEIIHTLTVLITTLYIVNSRKGIKNDRVE

MD5 = a9023d22c4aa1945dee9996df5f93c5d


  DNA Sequence

>fig|93062.19.peg.1149 Doubtful CDS. No database matches
atgaaactattttatatcgtatttcttattattatatggctgaatatatttttaggaaat
gaaatcatccatacactgactgttttaataacaacattgtatattgttaattcaagaaag
gggattaaaaatgacagagttgaataa


  DNA with Flanking Sequence

>fig|93062.19.peg.1149 Doubtful CDS. No database matches
ttttaacttttatttaaaatttgaaaggaagcatttcaatttcgagggttagtcaaagtt
gaataaattctttatgaaacaaggaaaagacatagctaattttattgattaatttcttta
aaactaatgatttgtttgatttaaaaatgtaatcgattacaatataaaaatacaaatatc
ttagaattaaatcaattaattaactattaaataaaaattaactatatattaactagtgta
aattaataaatagaaatagagaaaaagggtattaattatgtttggaatttcgtcgggaat
aaattttgccattacatagaaatatctaatagataacgaaaaagtatcgtatgtattttt
aatatagtgtaaaatattatatgtaaaataaaatgtaggtttttagttagaggcattata
agaaaattttgagtataggttagcttttaattatgaatcttattgaaatttgattaataa
aaatatgataggggattaaaatgaaactattttatatcgtatttcttattattatatggc
tgaatatatttttaggaaatgaaatcatccatacactgactgttttaataacaacattgt
atattgttaattcaagaaaggggattaaaaatgacagagttgaataatattataaactct
cttcaatctttgtttgagtctgaatcaggctataaaatttcgaaaaattcaggagttcca
tatcaaacagtacaagatttaagaaatgggaaaaccaaactagaagatgctagatttaga
acgattattaaactttatagttactatgtctcattaaaagaacactaatcatgggacaat
aaagtattgctataataatttaatcattaaatgaaggaatagagcctaagacataataaa
tcaatgtcttaggctctacaatattatattggtagtagttgaccgaatgaaaatgcccat
gtaacaagcatttttcaattataggcggggccccaacatagagaatttcaaaaagaaatt
ctacagacaatgcaagttggggtgggccccaacacagaagctgacgaaaagtcagcttac
aataatgtgcaagttggcggggccccaacatagtgaaattggattcccaatttctacaga
caatgca


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT01SA1099 Staphylococcus aureus N315     conserved hypothetical protein
cmr|NT03SA1139 Staphylococcus aureus MW2     conserved hypothetical protein
cmr|SACOL1174 Staphylococcus aureus subsp. aureus COL     hypothetical protein
dbj|BAB94910.1 Staphylococcus aureus subsp. aureus MW2     hypothetical protein
emb|CAG42873.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   hypothetical protein
emb|CAI80716.1 Staphylococcus aureus RF122 EMBL   hypothetical protein
fig|158878.14.peg.1194 Staphylococcus aureus subsp. aureus Mu50 FIG   Doubtful CDS. No database matches
fig|158879.11.peg.1082 Staphylococcus aureus subsp. aureus N315 FIG   Doubtful CDS. No database matches
fig|196620.1.peg.1045 Staphylococcus aureus subsp. aureus MW2 FIG   Doubtful CDS. No database matches
fig|196620.5.peg.1098 Staphylococcus aureus subsp. aureus MW2 FIG   Doubtful CDS. No database matches
fig|273036.3.peg.1240 Staphylococcus aureus RF122 FIG   Doubtful CDS. No database matches
fig|273036.6.peg.1092 Staphylococcus aureus RF122 FIG   Doubtful CDS. No database matches
fig|282459.1.peg.1090 Staphylococcus aureus subsp. aureus MSSA476 FIG   Doubtful CDS. No database matches
fig|282459.5.peg.1141 Staphylococcus aureus subsp. aureus MSSA476 FIG   Doubtful CDS. No database matches
fig|359786.13.peg.1299 Staphylococcus aureus subsp. aureus JH9 FIG   Doubtful CDS. No database matches
fig|359787.11.peg.1281 Staphylococcus aureus subsp. aureus JH1 FIG   Doubtful CDS. No database matches
fig|418127.6.peg.1176 Staphylococcus aureus subsp. aureus Mu3 FIG   Doubtful CDS. No database matches
fig|426430.8.peg.1176 Staphylococcus aureus subsp. aureus str. Newman FIG   Doubtful CDS. No database matches
fig|450394.6.peg.358 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   Doubtful CDS. No database matches
fig|451515.3.peg.1164 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Doubtful CDS. No database matches
fig|451516.9.peg.1168 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Doubtful CDS. No database matches
fig|452948.4.peg.686 Staphylococcus aureus 930918-3 FIG   Doubtful CDS. No database matches
fig|455227.3.peg.722 Staphylococcus aureus D30 FIG   Doubtful CDS. No database matches
fig|505321.3.peg.36 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   Doubtful CDS. No database matches
fig|546342.3.peg.1671 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Doubtful CDS. No database matches
fig|546343.3.peg.450 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Doubtful CDS. No database matches
fig|548474.3.peg.1150 Staphylococcus aureus subsp. aureus TCH130 FIG   Doubtful CDS. No database matches
fig|548475.3.peg.75 Staphylococcus aureus subsp. aureus TCH70 FIG   Doubtful CDS. No database matches
fig|553565.3.peg.1638 Staphylococcus aureus A5937 FIG   Doubtful CDS. No database matches
fig|553567.3.peg.1357 Staphylococcus aureus A5948 FIG   Doubtful CDS. No database matches
fig|553568.3.peg.1833 Staphylococcus aureus A6224 FIG   Doubtful CDS. No database matches
fig|553571.3.peg.2720 Staphylococcus aureus A6300 FIG   Doubtful CDS. No database matches
fig|553573.3.peg.2357 Staphylococcus aureus A8115 FIG   Doubtful CDS. No database matches
fig|553574.3.peg.3 Staphylococcus aureus A8117 FIG   Doubtful CDS. No database matches
fig|553577.3.peg.2074 Staphylococcus aureus A8796 FIG   Doubtful CDS. No database matches
fig|553580.3.peg.2240 Staphylococcus aureus A8819 FIG   Doubtful CDS. No database matches
fig|553581.3.peg.2032 Staphylococcus aureus A9299 FIG   Doubtful CDS. No database matches
fig|553588.3.peg.86 Staphylococcus aureus A9719 FIG   Doubtful CDS. No database matches
fig|553590.4.peg.212 Staphylococcus aureus A9754 FIG   Doubtful CDS. No database matches
fig|553592.3.peg.2337 Staphylococcus aureus A9763 FIG   Doubtful CDS. No database matches
fig|553594.3.peg.76 Staphylococcus aureus A9765 FIG   Doubtful CDS. No database matches
fig|553596.3.peg.2717 Staphylococcus aureus A9781 FIG   Doubtful CDS. No database matches
fig|553601.3.peg.2583 Staphylococcus aureus A10102 FIG   Doubtful CDS. No database matches
fig|585891.3.peg.1191 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Doubtful CDS. No database matches
fig|644279.4.peg.1174 Staphylococcus aureus subsp. aureus 132 FIG   Doubtful CDS. No database matches
fig|680649.3.peg.2580 Staphylococcus aureus subsp. aureus MR1 FIG   Doubtful CDS. No database matches
fig|681288.4.peg.1137 Staphylococcus aureus subsp. aureus ED98 FIG   Doubtful CDS. No database matches
fig|703339.3.peg.1136 Staphylococcus aureus 04-02981 FIG   Doubtful CDS. No database matches
fig|762962.3.peg.898 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   Doubtful CDS. No database matches
fig|93061.3.peg.1078 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Doubtful CDS. No database matches
fig|93061.5.peg.1030 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Doubtful CDS. No database matches
fig|93062.4.peg.1541 Staphylococcus aureus subsp. aureus COL FIG   Doubtful CDS. No database matches
gb|AAW36553.1 Staphylococcus aureus subsp. aureus COL     hypothetical protein SACOL1174
gb|ABD30234.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABR52101.1 Staphylococcus aureus subsp. aureus JH1     conserved hypothetical protein
gb|ABX29118.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     hypothetical protein USA300HOU_1100
gb|EES55097.1 Staphylococcus aureus subsp. aureus TCH70     conserved hypothetical protein
gb|EES93236.1 Staphylococcus aureus subsp. aureus USA300_TCH959     conserved hypothetical protein
gb|EES97161.1 Staphylococcus aureus subsp. aureus TCH130     conserved hypothetical protein
gb|EEV68721.1 Staphylococcus aureus A9719     hypothetical protein SAMG_02036
gb|EEW45468.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_1535
gb|EEW47786.1 Staphylococcus aureus D30     hypothetical protein SAD30_1600
gi|149946165 Staphylococcus aureus subsp. aureus JH1 NCBI   conserved hypothetical protein
gi|150393713 Staphylococcus aureus subsp. aureus JH1 NCBI   hypothetical protein SaurJH1_1247
gi|160368147 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_1100
gi|161509338 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_1100
gi|21204212 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein
gi|21282774 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein MW1045
gi|221138646 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   hypothetical protein SauraJK_08390
gi|251802440 Staphylococcus aureus subsp. aureus TCH70 NCBI   conserved hypothetical protein
gi|251814069 Staphylococcus aureus subsp. aureus TCH70 NCBI   conserved hypothetical protein
gi|253314598 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   hypothetical protein SauraC_00195
gi|253724507 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   conserved hypothetical protein
gi|253728432 Staphylococcus aureus subsp. aureus TCH130 NCBI   conserved hypothetical protein
gi|253731778 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   conserved hypothetical protein
gi|253733600 Staphylococcus aureus subsp. aureus TCH130 NCBI   conserved hypothetical protein
gi|255005949 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   hypothetical protein SauraM_05750
gi|257844339 Staphylococcus aureus A9719 NCBI   hypothetical protein SAMG_02036
gi|258419754 Staphylococcus aureus A9719 NCBI   hypothetical protein SAMG_02036
gi|259160443 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_1535
gi|259163226 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_1600
gi|49244445 Staphylococcus aureus subsp. aureus MSSA476 NCBI   hypothetical protein
gi|49486002 Staphylococcus aureus subsp. aureus MSSA476 NCBI   hypothetical protein SAS1097a
gi|57284459 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL1174
gi|57650273 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL1174
gi|82656302 Staphylococcus aureus RF122 NCBI   hypothetical protein
gi|82750771 Staphylococcus aureus RF122 NCBI   hypothetical protein SAB1028
gi|87202424 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88194866 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_01122
img|637151936 Staphylococcus aureus aureus COL IMG   hypothetical protein
img|637157326 Staphylococcus aureus aureus MSSA476 IMG   hypothetical protein
img|637298808 Staphylococcus aureus aureus MW2 IMG   hypothetical protein
img|637815982 Staphylococcus aureus RF122 IMG   hypothetical protein
img|637893759 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|640779334 Staphylococcus aureus aureus JH1 IMG   hypothetical protein
img|641309068 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   hypothetical protein
kegg|sab:SAB1028 Staphylococcus aureus RF122 KEGG   hypothetical protein
kegg|sac:SACOL1174 Staphylococcus aureus subsp. aureus COL KEGG   hypothetical protein
kegg|sah:SaurJH1_1247 Staphylococcus aureus subsp. aureus JH1 KEGG   hypothetical protein
kegg|sam:MW1045 Staphylococcus aureus subsp. aureus MW2 KEGG   hypothetical protein
kegg|sao:SAOUHSC_01122 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sas:SAS1097a   KEGG   hypothetical protein
kegg|sax:USA300HOU_1100 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   hypothetical protein
ref|NP_645862.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   hypothetical protein MW1045
ref|YP_001316388.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   hypothetical protein SaurJH1_1247
ref|YP_001574997.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   hypothetical protein USA300HOU_1100
ref|YP_043223.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   hypothetical protein SAS1097a
ref|YP_186037.1 Staphylococcus aureus subsp. aureus COL RefSeq   hypothetical protein SACOL1174
ref|YP_416512.1 Staphylococcus aureus RF122 RefSeq   hypothetical protein SAB1028
ref|YP_499666.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_01122
ref|ZP_03563448.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   hypothetical protein SauraJK_08390
ref|ZP_04828542.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   conserved hypothetical protein
ref|ZP_04837811.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   hypothetical protein SauraC_00195
ref|ZP_04865943.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   conserved hypothetical protein
ref|ZP_04867765.1 Staphylococcus aureus subsp. aureus TCH130 RefSeq   conserved hypothetical protein
ref|ZP_05144550.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   hypothetical protein SauraM_05750
ref|ZP_05682721.1 Staphylococcus aureus A9719 RefSeq   hypothetical protein SAMG_02036
tr|A6U0Y3 Staphylococcus aureus (strain JH1) TrEMBL   Putative uncharacterized protein
tr|A8Z1U5 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Putative uncharacterized protein
tr|C5N4Q1 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   Putative uncharacterized protein
tr|C5Q0U6 Staphylococcus aureus subsp. aureus TCH130 TrEMBL   Putative uncharacterized protein
tr|C5QIC6 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   Putative uncharacterized protein
tr|Q2G1X4 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein
tr|Q2YXB1 Staphylococcus aureus (strain bovine RF122 / ET3-1) TrEMBL   Putative uncharacterized protein
tr|Q5HGS0 Staphylococcus aureus (strain COL) TrEMBL   Putative uncharacterized protein
tr|Q6GA50 Staphylococcus aureus (strain MSSA476) TrEMBL   Putative uncharacterized protein
tr|Q8NX48 Staphylococcus aureus (strain MW2) TrEMBL   Putative uncharacterized protein MW1045


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search