The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93062.19.peg.1147: Staphylococcus aureus subsp. aureus COL

This feature in The SEED Viewer

NCBI Taxonomy Id: 93062

Current Assignment: FIG01108519: hypothetical protein
Translate Function Assignments



Context on contig NC_002951 from base 1174198 to 1184959 (10762 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1136 1174198 1174527 330 +       1: 1   Hypothetical protein, similarity with fibrinogen-binding protein Efb locus|SACOL1164, protein_id|YP_186027.1, gi|57650263, geneID|3238323
1137 1174689 1174805 117 + 161         FIG01108621: hypothetical protein locus|SACOL1165, protein_id|YP_186028.1, gi|57650264, geneID|3238216
1138 1175297 1174896 402 - 90         FIG017917: hypothetical protein locus|SACOL1166, protein_id|YP_186029.1, gi|57650265, geneID|3238392
1139 1175969 1176475 507 + 671         hypothetical protein locus|SACOL1167, protein_id|YP_186030.1, gi|57650266, geneID|3238163
1140 1176734 1177231 498 + 258     1: 1   Extracellular fibrinogen-binding protein Efb gene_name|efb, locus|SACOL1168, protein_id|YP_186031.1, gi|57650267, geneID|3238454
1141 1177385 1177735 351 + 153         Involved in expression of fibrinogen binding protein locus|SACOL1169, protein_id|YP_186032.1, gi|57650268, geneID|3238697
1142 1178052 1178294 243 + 316         FIG01108361: hypothetical protein  
1144 1178322 1178432 111 + 27         hypothetical protein  
1145 1178742 1178557 186 - 124         FIG01107916: hypothetical protein locus|SACOL1171, protein_id|YP_186034.1, gi|57650270, geneID|3238139
1146 1179200 1178952 249 - 209         FIG01108338: hypothetical protein  
1147 1179597 1179364 234 - 163         FIG01108519: hypothetical protein locus|SACOL1172, protein_id|YP_186035.1, gi|57650271, geneID|3238597
1148 1181033 1180074 960 - 476         Alpha-hemolysin precursor gene_name|hlY, locus|SACOL1173, protein_id|YP_186036.1, gi|57650272, geneID|3237999
1149 1181706 1181852 147 + 672         Doubtful CDS. No database matches locus|SACOL1174, protein_id|YP_186037.1, gi|57650273, geneID|3238304
1150 1181809 1182033 225 + -44         FIG01108126: hypothetical protein locus|SACOL1175, protein_id|YP_186038.1, gi|57650274, geneID|3238126
1151 1182242 1182421 180 + 208         hypothetical protein locus|SACOL1177, protein_id|YP_186040.1, gi|57650276, geneID|3238517
1152 1183306 1182590 717 - 168         FIG01107944: hypothetical protein locus|SACOL1178, protein_id|YP_186041.1, gi|57650277, geneID|3238464
1153 1184139 1183414 726 - 107         FIG01107880: hypothetical protein locus|SACOL1179, protein_id|YP_186042.1, gi|57650278, geneID|3238522
1154 1184959 1184234 726 - 94         FIG01108191: hypothetical protein locus|SACOL1180, protein_id|YP_186043.1, gi|57650279, geneID|3238179

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93062.19.peg.1147 FIG01108519: hypothetical protein
MVFNDWEINVVYSGEHEVVTNEKSLFVIDEFYDVAIAIYYLDGKLKVAHVNYGSDFTIDV
ANKVFELNIQNPNVDEH

MD5 = e0ca1f105b2d890a45894faaeed437cf


  DNA Sequence

>fig|93062.19.peg.1147 FIG01108519: hypothetical protein
atggtttttaatgattgggaaattaacgttgtatactcaggagagcatgaggttgtaaca
aacgaaaagagtttatttgtcattgacgaattttacgatgttgcaatcgcaatctattat
ttagatggaaaattaaaagtagctcatgtcaactatggttctgattttacaattgacgta
gctaataaagtttttgaattgaatattcaaaatccaaatgttgatgagcattaa


  DNA with Flanking Sequence

>fig|93062.19.peg.1147 FIG01108519: hypothetical protein
gaaaaagaagaaatgacaaattaatgtaaattatttgttcatgtacaaataaatataatt
tataactttagccgataacttcagaaatgatgtttttcggctaatttttatactgaattt
agtttaattaacttatgatatttttaatttaaactatctacttgatttgctttcctgact
taaaaattagactaaacatgacactatatgaggtaatttttaaaataagaaatttgaatt
ccatgttgtcaaaccctttatataaaagttttgaaattgttcaaaactttttgaacacat
tatgtgttaatatatttgcagaattattttaaaatcgttttaaaactatactgaaataag
aaatttaaaagtataattagtacatataattgaaaaagatttctagaaatacaattaatg
ttcatctagatattgtacgaagttgtatgaataagttaaacttaagttgaatcaatttaa
atgttcaaggaggttaacaaatggtttttaatgattgggaaattaacgttgtatactcag
gagagcatgaggttgtaacaaacgaaaagagtttatttgtcattgacgaattttacgatg
ttgcaatcgcaatctattatttagatggaaaattaaaagtagctcatgtcaactatggtt
ctgattttacaattgacgtagctaataaagtttttgaattgaatattcaaaatccaaatg
ttgatgagcattaaatattaaaaagcatttagaatcataaagagcatactatatatagcc
ttttacatgtaaagcaaatgaaaattagataatctaattatttcaacattaaacaatata
tcattataaagaagtttttaaaatagaagtataaggtggtgaacaaaaattaacattgtg
tataacattatagtatatatagcatgcatgattaatttcggattaattatagtcccatta
ttaacaacaaatgatgcggattttgtatggacttcttcatcattaatatatatgattctt
cttacgtcgattatcctaatagtttatattaaaactaaagatagcttacagttaacgata
tttatacttaatatagccttaattattctatactgtgcaccattactattcatttatgta
ttctagtgcttcattaatattttaatgcatcagtttaagtaaattccatttggaaaataa
aaagcaaatatcatcatcaaattaacatatttaa


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT01SA1096 Staphylococcus aureus N315     lacitehtopyh-related protein
cmr|NT02SA1150 Staphylococcus aureus Mu50     conserved hypothetical protein
cmr|NT03SA1137 Staphylococcus aureus MW2     conserved hypothetical protein
cmr|NT05SA1007 Staphylococcus aureus NCTC 8325     conserved hypothetical protein
cmr|NT09SA1089 Staphylococcus aureus subsp. aureus MSSA476     conserved hypothetical protein
cmr|SACOL1172 Staphylococcus aureus subsp. aureus COL     hypothetical protein
cmr|SAUSA300_1057 Staphylococcus aureus subsp. aureus USA300-FPR3757     conserved hypothetical protein
dbj|BAB42256.1 Staphylococcus aureus subsp. aureus N315     hypothetical protein
dbj|BAB57323.1 Staphylococcus aureus subsp. aureus Mu50     hypothetical protein
dbj|BAB94908.1 Staphylococcus aureus subsp. aureus MW2     hypothetical protein
dbj|BAF67344.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
dbj|BAF78034.1 Staphylococcus aureus subsp. aureus Mu3     hypothetical protein
emb|CAG42871.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   hypothetical protein
fig|158878.1.peg.1161 Staphylococcus aureus subsp. aureus Mu50 FIG   FIG01108519: hypothetical protein
fig|158878.14.peg.1191 Staphylococcus aureus subsp. aureus Mu50 FIG   FIG01108519: hypothetical protein
fig|158879.1.peg.1039 Staphylococcus aureus subsp. aureus N315 FIG   FIG01108519: hypothetical protein
fig|158879.11.peg.1079 Staphylococcus aureus subsp. aureus N315 FIG   FIG01108519: hypothetical protein
fig|196620.1.peg.1043 Staphylococcus aureus subsp. aureus MW2 FIG   FIG01108519: hypothetical protein
fig|196620.5.peg.1096 Staphylococcus aureus subsp. aureus MW2 FIG   FIG01108519: hypothetical protein
fig|282459.1.peg.1088 Staphylococcus aureus subsp. aureus MSSA476 FIG   FIG01108519: hypothetical protein
fig|282459.5.peg.1139 Staphylococcus aureus subsp. aureus MSSA476 FIG   FIG01108519: hypothetical protein
fig|359786.13.peg.1296 Staphylococcus aureus subsp. aureus JH9 FIG   FIG01108519: hypothetical protein
fig|359786.3.peg.325 Staphylococcus aureus subsp. aureus JH9 FIG   FIG01108519: hypothetical protein
fig|359787.11.peg.1278 Staphylococcus aureus subsp. aureus JH1 FIG   FIG01108519: hypothetical protein
fig|359787.3.peg.1559 Staphylococcus aureus subsp. aureus JH1 FIG   FIG01108519: hypothetical protein
fig|367830.3.peg.2486 Staphylococcus aureus subsp. aureus USA300 FIG   FIG01108519: hypothetical protein
fig|418127.4.peg.1062 Staphylococcus aureus subsp. aureus Mu3 FIG   FIG01108519: hypothetical protein
fig|418127.6.peg.1173 Staphylococcus aureus subsp. aureus Mu3 FIG   FIG01108519: hypothetical protein
fig|426430.6.peg.1042 Staphylococcus aureus subsp. aureus str. Newman FIG   FIG01108519: hypothetical protein
fig|426430.8.peg.1174 Staphylococcus aureus subsp. aureus str. Newman FIG   FIG01108519: hypothetical protein
fig|451515.3.peg.1162 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   FIG01108519: hypothetical protein
fig|451516.9.peg.1166 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   FIG01108519: hypothetical protein
fig|452948.4.peg.688 Staphylococcus aureus 930918-3 FIG   FIG01108519: hypothetical protein
fig|455227.3.peg.720 Staphylococcus aureus D30 FIG   FIG01108519: hypothetical protein
fig|505321.3.peg.2630 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   FIG01108519: hypothetical protein
fig|546342.3.peg.1673 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   FIG01108519: hypothetical protein
fig|546343.3.peg.452 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   FIG01108519: hypothetical protein
fig|548475.3.peg.73 Staphylococcus aureus subsp. aureus TCH70 FIG   FIG01108519: hypothetical protein
fig|553565.3.peg.1640 Staphylococcus aureus A5937 FIG   FIG01108519: hypothetical protein
fig|553567.3.peg.1355 Staphylococcus aureus A5948 FIG   FIG01108519: hypothetical protein
fig|553568.3.peg.2126 Staphylococcus aureus A6224 FIG   FIG01108519: hypothetical protein
fig|553571.3.peg.1123 Staphylococcus aureus A6300 FIG   FIG01108519: hypothetical protein
fig|553573.3.peg.1210 Staphylococcus aureus A8115 FIG   FIG01108519: hypothetical protein
fig|553574.3.peg.1525 Staphylococcus aureus A8117 FIG   FIG01108519: hypothetical protein
fig|553577.3.peg.2566 Staphylococcus aureus A8796 FIG   FIG01108519: hypothetical protein
fig|553580.3.peg.1111 Staphylococcus aureus A8819 FIG   FIG01108519: hypothetical protein
fig|553581.3.peg.649 Staphylococcus aureus A9299 FIG   FIG01108519: hypothetical protein
fig|553588.3.peg.2054 Staphylococcus aureus A9719 FIG   FIG01108519: hypothetical protein
fig|553590.4.peg.210 Staphylococcus aureus A9754 FIG   FIG01108519: hypothetical protein
fig|553592.3.peg.312 Staphylococcus aureus A9763 FIG   FIG01108519: hypothetical protein
fig|553594.3.peg.74 Staphylococcus aureus A9765 FIG   FIG01108519: hypothetical protein
fig|553596.3.peg.2025 Staphylococcus aureus A9781 FIG   FIG01108519: hypothetical protein
fig|553601.3.peg.2110 Staphylococcus aureus A10102 FIG   FIG01108519: hypothetical protein
fig|585891.3.peg.1188 Staphylococcus aureus subsp. aureus Mu50-omega FIG   FIG01108519: hypothetical protein
fig|644279.4.peg.1172 Staphylococcus aureus subsp. aureus 132 FIG   FIG01108519: hypothetical protein
fig|680649.3.peg.2613 Staphylococcus aureus subsp. aureus MR1 FIG   FIG01108519: hypothetical protein
fig|681288.4.peg.1134 Staphylococcus aureus subsp. aureus ED98 FIG   FIG01108519: hypothetical protein
fig|703339.3.peg.1133 Staphylococcus aureus 04-02981 FIG   FIG01108519: hypothetical protein
fig|762962.3.peg.901 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   FIG01108519: hypothetical protein
fig|93061.3.peg.1076 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   FIG01108519: hypothetical protein
fig|93061.5.peg.1028 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   FIG01108519: hypothetical protein
fig|93062.4.peg.1539 Staphylococcus aureus subsp. aureus COL FIG   FIG01108519: hypothetical protein
gb|AAW36551.1 Staphylococcus aureus subsp. aureus COL     hypothetical protein SACOL1172
gb|ABD22753.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     conserved hypothetical protein
gb|ABD30232.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABQ49020.1 Staphylococcus aureus subsp. aureus JH9     hypothetical protein SaurJH9_1220
gb|ABR52098.1 Staphylococcus aureus subsp. aureus JH1     conserved hypothetical protein
gb|ABX29116.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     hypothetical protein USA300HOU_1098
gb|EES55095.1 Staphylococcus aureus subsp. aureus TCH70     conserved hypothetical protein
gb|EEV27420.1 Staphylococcus aureus A9781     conserved hypothetical protein
gb|EEV65784.1 Staphylococcus aureus A9763     conserved hypothetical protein
gb|EEV66486.1 Staphylococcus aureus A9719     conserved hypothetical protein
gb|EEV73347.1 Staphylococcus aureus A9299     conserved hypothetical protein
gb|EEV75449.1 Staphylococcus aureus A8115     conserved hypothetical protein
gb|EEV78093.1 Staphylococcus aureus A6300     conserved hypothetical protein
gb|EEV79616.1 Staphylococcus aureus A6224     conserved hypothetical protein
gb|EEV83293.1 Staphylococcus aureus A5948     conserved hypothetical protein
gb|EEV85537.1 Staphylococcus aureus A5937     conserved hypothetical protein
gb|EEW45459.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_1526
gb|EEW47756.1 Staphylococcus aureus D30     hypothetical protein SAD30_1570
gi|13700960 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein
gi|14246931 Staphylococcus aureus subsp. aureus Mu50 NCBI   hypothetical protein
gi|147740722 Staphylococcus aureus subsp. aureus JH9 NCBI   hypothetical protein SaurJH9_1220
gi|148267653 Staphylococcus aureus subsp. aureus JH9 NCBI   hypothetical protein SaurJH9_1220
gi|149946162 Staphylococcus aureus subsp. aureus JH1 NCBI   conserved hypothetical protein
gi|150374084 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|150393710 Staphylococcus aureus subsp. aureus JH1 NCBI   hypothetical protein SaurJH1_1244
gi|151221284 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_1072
gi|156721617 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein
gi|156979482 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_1151
gi|15924151 Staphylococcus aureus subsp. aureus Mu50 NCBI   hypothetical protein SAV1161
gi|15926744 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA1005
gi|160368145 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_1098
gi|161509336 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_1098
gi|21204210 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein
gi|21282772 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein MW1043
gi|221138648 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   hypothetical protein SauraJK_08400
gi|221140443 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   hypothetical protein SauraJ_02261
gi|251802438 Staphylococcus aureus subsp. aureus TCH70 NCBI   conserved hypothetical protein
gi|251814067 Staphylococcus aureus subsp. aureus TCH70 NCBI   conserved hypothetical protein
gi|253317057 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   hypothetical protein SauraC_13159
gi|255005946 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   hypothetical protein SauraM_05735
gi|257789080 Staphylococcus aureus A9781 NCBI   conserved hypothetical protein
gi|257795108 Staphylococcus aureus A9781 NCBI   conserved hypothetical protein
gi|257841339 Staphylococcus aureus A9763 NCBI   conserved hypothetical protein
gi|257842058 Staphylococcus aureus A9719 NCBI   conserved hypothetical protein
gi|257849370 Staphylococcus aureus A9299 NCBI   conserved hypothetical protein
gi|257851510 Staphylococcus aureus A8115 NCBI   conserved hypothetical protein
gi|257855152 Staphylococcus aureus A6300 NCBI   conserved hypothetical protein
gi|257856713 Staphylococcus aureus A6224 NCBI   conserved hypothetical protein
gi|257860466 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|257862772 Staphylococcus aureus A5937 NCBI   conserved hypothetical protein
gi|258407184 Staphylococcus aureus A9763 NCBI   conserved hypothetical protein
gi|258421725 Staphylococcus aureus A9719 NCBI   conserved hypothetical protein
gi|258432930 Staphylococcus aureus A9299 NCBI   conserved hypothetical protein
gi|258443420 Staphylococcus aureus A8115 NCBI   conserved hypothetical protein
gi|258446094 Staphylococcus aureus A6300 NCBI   conserved hypothetical protein
gi|258449793 Staphylococcus aureus A6224 NCBI   conserved hypothetical protein
gi|258451858 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|258454892 Staphylococcus aureus A5937 NCBI   conserved hypothetical protein
gi|259160434 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_1526
gi|259163196 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_1570
gi|49244443 Staphylococcus aureus subsp. aureus MSSA476 NCBI   hypothetical protein
gi|49486000 Staphylococcus aureus subsp. aureus MSSA476 NCBI   hypothetical protein SAS1096
gi|57284457 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL1172
gi|57650271 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL1172
gi|87128239 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   conserved hypothetical protein
gi|87162265 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   hypothetical protein SAUSA300_1057
gi|87202422 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88194864 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_01120
img|637092658 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|637099672 Staphylococcus aureus aureus Mu50 IMG   hypothetical protein
img|637151934 Staphylococcus aureus aureus COL IMG   hypothetical protein
img|637157324 Staphylococcus aureus aureus MSSA476 IMG   hypothetical protein
img|637298806 Staphylococcus aureus aureus MW2 IMG   hypothetical protein
img|637887709 Staphylococcus aureus aureus USA300 IMG   hypothetical protein
img|637893757 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|639109547 Staphylococcus aureus aureus JH1 IMG   conserved hypothetical protein
img|640565571 Staphylococcus aureus aureus JH9 IMG   hypothetical protein
img|640779331 Staphylococcus aureus aureus JH1 IMG   hypothetical protein
img|640795452 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|640903894 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
img|641309066 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   hypothetical protein
img|641771480 Staphylococcus aureus aureus USA300_TCH959 IMG   hypothetical protein
kegg|saa:SAUSA300_1057 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   hypothetical protein
kegg|sac:SACOL1172 Staphylococcus aureus subsp. aureus COL KEGG   hypothetical protein
kegg|sae:NWMN_1072 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sah:SaurJH1_1244 Staphylococcus aureus subsp. aureus JH1 KEGG   hypothetical protein
kegg|saj:SaurJH9_1220 Staphylococcus aureus subsp. aureus JH9 KEGG   hypothetical protein
kegg|sam:MW1043 Staphylococcus aureus subsp. aureus MW2 KEGG   hypothetical protein
kegg|sao:SAOUHSC_01120 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sas:SAS1096   KEGG   hypothetical protein
kegg|sau:SA1005   KEGG   hypothetical protein
kegg|sav:SAV1161   KEGG   hypothetical protein
kegg|saw:SAHV_1151 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
kegg|sax:USA300HOU_1098 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   hypothetical protein
ref|NP_371685.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   hypothetical protein SAV1161
ref|NP_374277.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA1005
ref|NP_645860.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   hypothetical protein MW1043
ref|YP_001246596.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   hypothetical protein SaurJH9_1220
ref|YP_001316385.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   hypothetical protein SaurJH1_1244
ref|YP_001332106.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_1072
ref|YP_001441741.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_1151
ref|YP_001574995.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   hypothetical protein USA300HOU_1098
ref|YP_043221.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   hypothetical protein SAS1096
ref|YP_186035.1 Staphylococcus aureus subsp. aureus COL RefSeq   hypothetical protein SACOL1172
ref|YP_493755.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   hypothetical protein SAUSA300_1057
ref|YP_499664.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_01120
ref|ZP_03563450.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   hypothetical protein SauraJK_08400
ref|ZP_03564936.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   hypothetical protein SauraJ_02261
ref|ZP_04828540.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   conserved hypothetical protein
ref|ZP_04840270.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   hypothetical protein SauraC_13159
ref|ZP_05144547.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   hypothetical protein SauraM_05735
ref|ZP_05644087.1 Staphylococcus aureus A9781 RefSeq   conserved hypothetical protein
ref|ZP_05680333.1 Staphylococcus aureus A9763 RefSeq   conserved hypothetical protein
ref|ZP_05684646.1 Staphylococcus aureus A9719 RefSeq   conserved hypothetical protein
ref|ZP_05688619.1 Staphylococcus aureus A9299 RefSeq   conserved hypothetical protein
ref|ZP_05691763.1 Staphylococcus aureus A8115 RefSeq   conserved hypothetical protein
ref|ZP_05694256.1 Staphylococcus aureus A6300 RefSeq   conserved hypothetical protein
ref|ZP_05697891.1 Staphylococcus aureus A6224 RefSeq   conserved hypothetical protein
ref|ZP_05699879.1 Staphylococcus aureus A5948 RefSeq   conserved hypothetical protein
ref|ZP_05702855.1 Staphylococcus aureus A5937 RefSeq   conserved hypothetical protein
tr|A5IS47 Staphylococcus aureus (strain JH9) TrEMBL   Putative uncharacterized protein
tr|A6QG62 Staphylococcus aureus (strain Newman) TrEMBL   Putative uncharacterized protein
tr|A6U0Y0 Staphylococcus aureus (strain JH1) TrEMBL   Putative uncharacterized protein
tr|A7X192 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Putative uncharacterized protein
tr|A8Z1U3 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Putative uncharacterized protein
tr|C5QIC4 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   Putative uncharacterized protein
tr|Q2FHS3 Staphylococcus aureus (strain USA300) TrEMBL   Putative uncharacterized protein
tr|Q2G1X1 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein
tr|Q5HGS2 Staphylococcus aureus (strain COL) TrEMBL   Putative uncharacterized protein
tr|Q6GA52 Staphylococcus aureus (strain MSSA476) TrEMBL   Putative uncharacterized protein
tr|Q7A140 Staphylococcus aureus (strain MW2) TrEMBL   Putative uncharacterized protein MW1043
tr|Q7A634 Staphylococcus aureus (strain N315) TrEMBL   Putative uncharacterized protein SA1005
tr|Q99UU7 Staphylococcus aureus (strain Mu50 / ATCC 700699) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search