The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93061.5.peg.613: Staphylococcus aureus subsp. aureus NCTC 8325

This feature in The SEED Viewer

NCBI Taxonomy Id: 93061

Current Assignment: FIG01107852: hypothetical protein
Translate Function Assignments



Context on contig NC_007795 from base 664876 to 675684 (10809 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
606 664876 665592 717 +           Transcriptional regulatory protein YeeN locus|SAOUHSC_00675, protein_id|YP_499234.1, gi|88194440, geneID|3919438
607 665592 666065 474 + -1         FIG018171: hypothetical protein of Cupin superfamily locus|SAOUHSC_00676, protein_id|YP_499235.1, gi|88194441, geneID|3919439
608 666157 666273 117 + 91         FIG01109083: hypothetical protein locus|SAOUHSC_00677, protein_id|YP_499236.1, gi|88194442, geneID|3919440
609 666418 667062 645 + 144         FIG01107967: hypothetical protein locus|SAOUHSC_00678, protein_id|YP_499237.1, gi|88194443, geneID|3919441
610 667178 668044 867 + 115         LysR family transcriptional regulator locus|SAOUHSC_00679, protein_id|YP_499238.1, gi|88194444, geneID|3919442
611 668245 669465 1221 + 200         Sugar efflux transpoter locus|SAOUHSC_00681, protein_id|YP_499240.1, gi|88194446, geneID|3919444
612 669462 669950 489 + -4         Putative membrane protein locus|SAOUHSC_00682, protein_id|YP_499241.1, gi|88194447, geneID|3919445
613 670738 670049 690 - 98         FIG01107852: hypothetical protein locus|SAOUHSC_00683, protein_id|YP_499242.1, gi|88194448, geneID|3919446
614 670991 671308 318 + 252         FIG01108170: hypothetical protein locus|SAOUHSC_00684, protein_id|YP_499243.1, gi|88194449, geneID|3919447
615 671375 671770 396 + 66         FIG01108219: hypothetical protein locus|SAOUHSC_00685, protein_id|YP_499244.1, gi|88194450, geneID|3920989
616 671908 672207 300 + 137         FIG01107934: hypothetical protein locus|SAOUHSC_00686, protein_id|YP_499245.1, gi|88194451, geneID|3920990
617 672287 672829 543 + 79         Acetyltransferase, GNAT family locus|SAOUHSC_00687, protein_id|YP_499246.1, gi|88194452, geneID|3920991
618 673491 672925 567 - 95         Lysine decarboxylase family locus|SAOUHSC_00688, protein_id|YP_499247.1, gi|88194453, geneID|3920992
619 673951 673493 459 - 1         FIG01108093: hypothetical protein locus|SAOUHSC_00689, protein_id|YP_499248.1, gi|88194454, geneID|3920993
620 674637 673954 684 - 2         FIG01108121: hypothetical protein locus|SAOUHSC_00690, protein_id|YP_499249.1, gi|88194455, geneID|3920994
621 675684 674809 876 - 171     1: 1   Undecaprenyl-diphosphatase (EC 3.6.1.27) locus|SAOUHSC_00691, protein_id|YP_499250.1, gi|88194456, geneID|3920995

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93061.5.peg.613 FIG01107852: hypothetical protein
MKSTAQLTKENNVKSLRLSNTDREIFENYMTYMRSDFRVNPHDTELIINRILKQLLSAEQ
HGLLALDFFNHDPKAHAIKELKAMPNETFKNIFKYIYQHIVLLIGIVSFLKGFLGFFMEK
NGSNLYFVSFPFSVVVGFFIVFLFIWFSFKTIQLQCFNNSNWIWIFTYLAIILLIVGFFY
VFFIPQSLLAFGPYIQVSNWVFIIFSFIVMPIGLRIERNISKKHSHTFL

MD5 = 93fe2d81c167e8c0c733f2dc0a71a894


  DNA Sequence

>fig|93061.5.peg.613 FIG01107852: hypothetical protein
atgaaaagtactgcgcaattaacaaaagaaaataatgttaaatcattaagattaagcaat
actgatagagaaatcttcgagaattatatgacttatatgcgctctgactttcgcgtcaac
cctcatgatacagagttaattattaaccgtatactcaaacaattattaagcgcagaacaa
catggtttattagccttagattttttcaatcacgacccaaaagcacatgcaataaaagaa
ctaaaagcgatgcctaatgaaacatttaaaaatatttttaaatatatctatcaacacatc
gttctattaattgggattgttagttttctcaaaggatttttaggatttttcatggaaaaa
aatggaagtaatttatattttgtttcattcccgttttcagtagtcgttggattctttatt
gtctttttatttatatggtttagttttaaaacaatacaactgcagtgttttaacaattca
aattggatatggatattcacctatttagcaatcattctactaattgtaggatttttctat
gtattctttattccacaatcattacttgcctttggaccatatattcaggtaagcaattgg
gtatttattatattttcatttatagttatgcctattggattacgcattgaaagaaatatt
tcgaaaaaacattctcatacatttttataa


  DNA with Flanking Sequence

>fig|93061.5.peg.613 FIG01107852: hypothetical protein
ggcaaattatttttatgaattgtattgcttattcgctttgcattcatagtttttgcccat
ttttcaagcgcaatcttcagttgcgtagctattcccagtttgcgaaattgtggttcaaca
tatagcagttcaatgttaaccatacttttttcattactaaaatgtccccaaataaacgct
attaattgaccttcattttcatatatataaattttatcatttgtatgttctaatcttgaa
catatcatctcgtacctaagagcaatactcagtttagtacatttatagttggattctact
tgcgacaataatgtctcatgtatattagctatttgcttgatataattatgttcatcttta
ttaagtgtcctcattttcctctccaatattaatcgttatatttatgcgtttaatatgata
tgattgaccttattaatactataaaatcatttccattttaatttggaattaaacattttt
aaaggagcgcttaagtaacaatgaaaagtactgcgcaattaacaaaagaaaataatgtta
aatcattaagattaagcaatactgatagagaaatcttcgagaattatatgacttatatgc
gctctgactttcgcgtcaaccctcatgatacagagttaattattaaccgtatactcaaac
aattattaagcgcagaacaacatggtttattagccttagattttttcaatcacgacccaa
aagcacatgcaataaaagaactaaaagcgatgcctaatgaaacatttaaaaatattttta
aatatatctatcaacacatcgttctattaattgggattgttagttttctcaaaggatttt
taggatttttcatggaaaaaaatggaagtaatttatattttgtttcattcccgttttcag
tagtcgttggattctttattgtctttttatttatatggtttagttttaaaacaatacaac
tgcagtgttttaacaattcaaattggatatggatattcacctatttagcaatcattctac
taattgtaggatttttctatgtattctttattccacaatcattacttgcctttggaccat
atattcaggtaagcaattgggtatttattatattttcatttatagttatgcctattggat
tacgcattgaaagaaatatttcgaaaaaacattctcatacatttttataaacaaaaagct
tattacatcatatgcgaatttggtactgttaatgataaaatcactaaattacagttaccg
aaaaacatattttgcaataagctttttattaattaatcaataaagcatctataaagaacc
atacaatcattataaacataatgattgcttgagctatactacttgttaaaaatgctacga
ttgaacctatacttactttaactgctctttcaaatgaatagccttgtattaattcaacta
tgaataccaaaataaaaggtataataataattccaaatggcggtaaaacaaaacatccaa
taaccacaccaattaaagctgcatactctccaaacttagaaccaccgaagcgattcacaa
aatatttattagctaaaaagtcggcacataaaattaatattgttagcaatgccatagata
cataaaacacccatgataaatgctgattatgaaagccaaattgatagattaaaaagccaa
cccataatac


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT01SA0680 Staphylococcus aureus N315     conserved hypothetical protein
cmr|NT02SA0679 Staphylococcus aureus Mu50     conserved hypothetical protein
cmr|NT03SA0703 Staphylococcus aureus MW2     conserved hypothetical protein
cmr|NT05SA0614 Staphylococcus aureus NCTC 8325     conserved hypothetical protein
cmr|NT09SA0652 Staphylococcus aureus subsp. aureus MSSA476     conserved hypothetical protein
cmr|SACOL0735 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
cmr|SAUSA300_0661 Staphylococcus aureus subsp. aureus USA300-FPR3757     conserved hypothetical protein
dbj|BAB41863.1 Staphylococcus aureus subsp. aureus N315     conserved hypothetical protein
dbj|BAB56837.1 Staphylococcus aureus subsp. aureus Mu50     conserved hypothetical protein
dbj|BAB94502.1 Staphylococcus aureus subsp. aureus MW2     conserved hypothetical protein
dbj|BAF66916.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
dbj|BAF77555.1 Staphylococcus aureus subsp. aureus Mu3     conserved hypothetical protein
emb|CAG42416.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   putative membrane protein
fig|158878.1.peg.675 Staphylococcus aureus subsp. aureus Mu50 FIG   FIG01107852: hypothetical protein
fig|158878.14.peg.684 Staphylococcus aureus subsp. aureus Mu50 FIG   FIG01107852: hypothetical protein
fig|158879.1.peg.646 Staphylococcus aureus subsp. aureus N315 FIG   FIG01107852: hypothetical protein
fig|158879.11.peg.661 Staphylococcus aureus subsp. aureus N315 FIG   FIG01107852: hypothetical protein
fig|196620.1.peg.637 Staphylococcus aureus subsp. aureus MW2 FIG   FIG01107852: hypothetical protein
fig|196620.5.peg.671 Staphylococcus aureus subsp. aureus MW2 FIG   FIG01107852: hypothetical protein
fig|282459.1.peg.635 Staphylococcus aureus subsp. aureus MSSA476 FIG   FIG01107852: hypothetical protein
fig|282459.5.peg.667 Staphylococcus aureus subsp. aureus MSSA476 FIG   FIG01107852: hypothetical protein
fig|359786.13.peg.753 Staphylococcus aureus subsp. aureus JH9 FIG   FIG01107852: hypothetical protein
fig|359786.3.peg.2412 Staphylococcus aureus subsp. aureus JH9 FIG   FIG01107852: hypothetical protein
fig|359787.11.peg.744 Staphylococcus aureus subsp. aureus JH1 FIG   FIG01107852: hypothetical protein
fig|359787.3.peg.2557 Staphylococcus aureus subsp. aureus JH1 FIG   FIG01107852: hypothetical protein
fig|367830.3.peg.1295 Staphylococcus aureus subsp. aureus USA300 FIG   FIG01107852: hypothetical protein
fig|418127.4.peg.632 Staphylococcus aureus subsp. aureus Mu3 FIG   FIG01107852: hypothetical protein
fig|418127.6.peg.680 Staphylococcus aureus subsp. aureus Mu3 FIG   FIG01107852: hypothetical protein
fig|426430.6.peg.635 Staphylococcus aureus subsp. aureus str. Newman FIG   FIG01107852: hypothetical protein
fig|426430.8.peg.697 Staphylococcus aureus subsp. aureus str. Newman FIG   FIG01107852: hypothetical protein
fig|450394.6.peg.1237 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   FIG01107852: hypothetical protein
fig|451515.3.peg.735 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   FIG01107852: hypothetical protein
fig|451516.9.peg.739 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   FIG01107852: hypothetical protein
fig|452948.4.peg.779 Staphylococcus aureus 930918-3 FIG   FIG01107852: hypothetical protein
fig|455227.3.peg.334 Staphylococcus aureus D30 FIG   FIG01107852: hypothetical protein
fig|546342.3.peg.2329 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   FIG01107852: hypothetical protein
fig|546343.3.peg.905 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   FIG01107852: hypothetical protein
fig|548475.3.peg.975 Staphylococcus aureus subsp. aureus TCH70 FIG   FIG01107852: hypothetical protein
fig|553565.3.peg.810 Staphylococcus aureus A5937 FIG   FIG01107852: hypothetical protein
fig|553567.3.peg.2381 Staphylococcus aureus A5948 FIG   FIG01107852: hypothetical protein
fig|553568.3.peg.2007 Staphylococcus aureus A6224 FIG   FIG01107852: hypothetical protein
fig|553571.3.peg.907 Staphylococcus aureus A6300 FIG   FIG01107852: hypothetical protein
fig|553573.3.peg.372 Staphylococcus aureus A8115 FIG   FIG01107852: hypothetical protein
fig|553574.3.peg.1772 Staphylococcus aureus A8117 FIG   FIG01107852: hypothetical protein
fig|553577.3.peg.1190 Staphylococcus aureus A8796 FIG   FIG01107852: hypothetical protein
fig|553580.3.peg.1535 Staphylococcus aureus A8819 FIG   FIG01107852: hypothetical protein
fig|553581.3.peg.551 Staphylococcus aureus A9299 FIG   FIG01107852: hypothetical protein
fig|553588.3.peg.1951 Staphylococcus aureus A9719 FIG   FIG01107852: hypothetical protein
fig|553590.4.peg.1413 Staphylococcus aureus A9754 FIG   FIG01107852: hypothetical protein
fig|553592.3.peg.2661 Staphylococcus aureus A9763 FIG   FIG01107852: hypothetical protein
fig|553594.3.peg.977 Staphylococcus aureus A9765 FIG   FIG01107852: hypothetical protein
fig|553596.3.peg.1922 Staphylococcus aureus A9781 FIG   FIG01107852: hypothetical protein
fig|553601.3.peg.256 Staphylococcus aureus A10102 FIG   FIG01107852: hypothetical protein
fig|585891.3.peg.683 Staphylococcus aureus subsp. aureus Mu50-omega FIG   FIG01107852: hypothetical protein
fig|644279.4.peg.760 Staphylococcus aureus subsp. aureus 132 FIG   FIG01107852: hypothetical protein
fig|681288.4.peg.630 Staphylococcus aureus subsp. aureus ED98 FIG   FIG01107852: hypothetical protein
fig|703339.3.peg.659 Staphylococcus aureus 04-02981 FIG   FIG01107852: hypothetical protein
fig|762962.3.peg.1307 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   FIG01107852: hypothetical protein
fig|93061.3.peg.458 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   FIG01107852: hypothetical protein
fig|93062.19.peg.714 Staphylococcus aureus subsp. aureus COL FIG   FIG01107852: hypothetical protein
fig|93062.4.peg.224 Staphylococcus aureus subsp. aureus COL FIG   FIG01107852: hypothetical protein
gb|AAW37796.1 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
gb|ABD20454.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     conserved hypothetical protein
gb|ABD29816.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABQ48502.1 Staphylococcus aureus subsp. aureus JH9     hypothetical protein SaurJH9_0699
gb|ABR51571.1 Staphylococcus aureus subsp. aureus JH1     conserved hypothetical protein
gb|ABX28719.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     hypothetical membrane protein
gb|EES55404.1 Staphylococcus aureus subsp. aureus TCH70     conserved hypothetical protein
gb|EES93767.1 Staphylococcus aureus subsp. aureus USA300_TCH959     conserved hypothetical protein
gb|EEV27316.1 Staphylococcus aureus A9781     conserved hypothetical protein
gb|EEV63593.1 Staphylococcus aureus A9763     conserved hypothetical protein
gb|EEV66968.1 Staphylococcus aureus A9719     conserved hypothetical protein
gb|EEV73453.1 Staphylococcus aureus A9299     conserved hypothetical protein
gb|EEV76092.1 Staphylococcus aureus A8115     conserved hypothetical protein
gb|EEV78382.1 Staphylococcus aureus A6300     conserved hypothetical protein
gb|EEV80080.1 Staphylococcus aureus A6224     conserved hypothetical protein
gb|EEV82248.1 Staphylococcus aureus A5948     conserved hypothetical protein
gb|EEV86695.1 Staphylococcus aureus A5937     conserved hypothetical protein
gb|EEW45408.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_1854
gb|EEW48058.1 Staphylococcus aureus D30     hypothetical protein SAD30_2140
gi|13700566 Staphylococcus aureus subsp. aureus N315 NCBI   conserved hypothetical protein
gi|14246444 Staphylococcus aureus subsp. aureus Mu50 NCBI   conserved hypothetical protein
gi|147740204 Staphylococcus aureus subsp. aureus JH9 NCBI   hypothetical protein SaurJH9_0699
gi|148267135 Staphylococcus aureus subsp. aureus JH9 NCBI   hypothetical protein SaurJH9_0699
gi|149945635 Staphylococcus aureus subsp. aureus JH1 NCBI   conserved hypothetical protein
gi|150373656 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|150393183 Staphylococcus aureus subsp. aureus JH1 NCBI   hypothetical protein SaurJH1_0715
gi|151220856 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_0644
gi|156721138 Staphylococcus aureus subsp. aureus Mu3 NCBI   conserved hypothetical protein
gi|156979003 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_0672
gi|15923665 Staphylococcus aureus subsp. aureus Mu50 NCBI   hypothetical protein SAV0675
gi|15926352 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA0630
gi|160367748 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical membrane protein
gi|161508939 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_0698
gi|21203803 Staphylococcus aureus subsp. aureus MW2 NCBI   conserved hypothetical protein
gi|21282366 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein MW0637
gi|221139278 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   hypothetical protein SauraJK_11640
gi|221140891 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   hypothetical protein SauraJ_04533
gi|251802747 Staphylococcus aureus subsp. aureus TCH70 NCBI   conserved hypothetical protein
gi|251813641 Staphylococcus aureus subsp. aureus TCH70 NCBI   conserved hypothetical protein
gi|253725038 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   conserved hypothetical protein
gi|253731297 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   conserved hypothetical protein
gi|255005467 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   hypothetical protein SauraM_03330
gi|257788976 Staphylococcus aureus A9781 NCBI   conserved hypothetical protein
gi|257795004 Staphylococcus aureus A9781 NCBI   conserved hypothetical protein
gi|257839114 Staphylococcus aureus A9763 NCBI   conserved hypothetical protein
gi|257842544 Staphylococcus aureus A9719 NCBI   conserved hypothetical protein
gi|257849483 Staphylococcus aureus A9299 NCBI   conserved hypothetical protein
gi|257852165 Staphylococcus aureus A8115 NCBI   conserved hypothetical protein
gi|257855444 Staphylococcus aureus A6300 NCBI   conserved hypothetical protein
gi|257857181 Staphylococcus aureus A6224 NCBI   conserved hypothetical protein
gi|257859394 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|257863939 Staphylococcus aureus A5937 NCBI   conserved hypothetical protein
gi|258418321 Staphylococcus aureus A9763 NCBI   conserved hypothetical protein
gi|258421618 Staphylococcus aureus A9719 NCBI   conserved hypothetical protein
gi|258430811 Staphylococcus aureus A9299 NCBI   conserved hypothetical protein
gi|258441696 Staphylococcus aureus A8115 NCBI   conserved hypothetical protein
gi|258445868 Staphylococcus aureus A6300 NCBI   conserved hypothetical protein
gi|258449673 Staphylococcus aureus A6224 NCBI   conserved hypothetical protein
gi|258452883 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|258454074 Staphylococcus aureus A5937 NCBI   conserved hypothetical protein
gi|259160382 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_1854
gi|259163501 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_2140
gi|49243990 Staphylococcus aureus subsp. aureus MSSA476 NCBI   putative membrane protein
gi|49485547 Staphylococcus aureus subsp. aureus MSSA476 NCBI   hypothetical protein SAS0640
gi|57285702 Staphylococcus aureus subsp. aureus COL NCBI   conserved hypothetical protein
gi|57651516 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL0735
gi|87125940 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   conserved hypothetical protein
gi|87159966 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   hypothetical protein SAUSA300_0661
gi|87202006 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88194448 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_00683
img|637092262 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|637099189 Staphylococcus aureus aureus Mu50 IMG   hypothetical protein
img|637151510 Staphylococcus aureus aureus COL IMG   hypothetical protein
img|637156868 Staphylococcus aureus aureus MSSA476 IMG   hypothetical protein
img|637298397 Staphylococcus aureus aureus MW2 IMG   hypothetical protein
img|637887315 Staphylococcus aureus aureus USA300 IMG   hypothetical protein
img|637893332 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|639107991 Staphylococcus aureus aureus JH1 IMG   conserved hypothetical protein
img|640565049 Staphylococcus aureus aureus JH9 IMG   hypothetical protein
img|640778800 Staphylococcus aureus aureus JH1 IMG   hypothetical protein
img|640795020 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|640903411 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
img|641308665 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   hypothetical membrane protein
img|641772330 Staphylococcus aureus aureus USA300_TCH959 IMG   hypothetical membrane protein
kegg|saa:SAUSA300_0661 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   hypothetical protein
kegg|sac:SACOL0735 Staphylococcus aureus subsp. aureus COL KEGG   hypothetical protein
kegg|sae:NWMN_0644 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sah:SaurJH1_0715 Staphylococcus aureus subsp. aureus JH1 KEGG   hypothetical protein
kegg|saj:SaurJH9_0699 Staphylococcus aureus subsp. aureus JH9 KEGG   hypothetical protein
kegg|sam:MW0637 Staphylococcus aureus subsp. aureus MW2 KEGG   hypothetical protein
kegg|sao:SAOUHSC_00683 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sas:SAS0640   KEGG   hypothetical protein
kegg|sau:SA0630   KEGG   hypothetical protein
kegg|sav:SAV0675   KEGG   hypothetical protein
kegg|saw:SAHV_0672 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
kegg|sax:USA300HOU_0698 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   hypothetical protein
ref|NP_371199.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   hypothetical protein SAV0675
ref|NP_373885.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA0630
ref|NP_645454.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   hypothetical protein MW0637
ref|YP_001246078.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   hypothetical protein SaurJH9_0699
ref|YP_001315858.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   hypothetical protein SaurJH1_0715
ref|YP_001331678.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_0644
ref|YP_001441262.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_0672
ref|YP_001574598.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   hypothetical protein USA300HOU_0698
ref|YP_042768.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   hypothetical protein SAS0640
ref|YP_185614.1 Staphylococcus aureus subsp. aureus COL RefSeq   hypothetical protein SACOL0735
ref|YP_493364.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   hypothetical protein SAUSA300_0661
ref|YP_499242.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_00683
ref|ZP_03564078.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   hypothetical protein SauraJK_11640
ref|ZP_03565384.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   hypothetical protein SauraJ_04533
ref|ZP_04828114.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   conserved hypothetical protein
ref|ZP_04865462.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   conserved hypothetical protein
ref|ZP_05144068.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   hypothetical protein SauraM_03330
ref|ZP_05643983.1 Staphylococcus aureus A9781 RefSeq   conserved hypothetical protein
ref|ZP_05682586.1 Staphylococcus aureus A9763 RefSeq   conserved hypothetical protein
ref|ZP_05684543.1 Staphylococcus aureus A9719 RefSeq   conserved hypothetical protein
ref|ZP_05688523.1 Staphylococcus aureus A9299 RefSeq   conserved hypothetical protein
ref|ZP_05690968.1 Staphylococcus aureus A8115 RefSeq   conserved hypothetical protein
ref|ZP_05694045.1 Staphylococcus aureus A6300 RefSeq   conserved hypothetical protein
ref|ZP_05697775.1 Staphylococcus aureus A6224 RefSeq   conserved hypothetical protein
ref|ZP_05700877.1 Staphylococcus aureus A5948 RefSeq   conserved hypothetical protein
ref|ZP_05702046.1 Staphylococcus aureus A5937 RefSeq   conserved hypothetical protein
tr|A5IQM9 Staphylococcus aureus (strain JH9) TrEMBL   Putative uncharacterized protein
tr|A6QEY4 Staphylococcus aureus (strain Newman) TrEMBL   Putative uncharacterized protein
tr|A6TZF3 Staphylococcus aureus (strain JH1) TrEMBL   Putative uncharacterized protein
tr|A7WZE4 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Putative uncharacterized protein
tr|A8Z198 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Hypothetical membrane protein
tr|C5N3C0 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   Putative uncharacterized protein
tr|C5QH48 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   Putative uncharacterized protein
tr|Q2FIW4 Staphylococcus aureus (strain USA300) TrEMBL   Putative uncharacterized protein
tr|Q2G0C2 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein
tr|Q5HHZ3 Staphylococcus aureus (strain COL) TrEMBL   Putative uncharacterized protein
tr|Q6GBF5 Staphylococcus aureus (strain MSSA476) TrEMBL   Putative membrane protein
tr|Q7A1K3 Staphylococcus aureus (strain MW2) TrEMBL   Putative uncharacterized protein MW0637
tr|Q7A6Y0 Staphylococcus aureus (strain N315) TrEMBL   Putative uncharacterized protein SA0630
tr|Q99VU6 Staphylococcus aureus (strain Mu50 / ATCC 700699) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search