The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93061.5.peg.1898: Staphylococcus aureus subsp. aureus NCTC 8325

This feature in The SEED Viewer

NCBI Taxonomy Id: 93061

Current Assignment: Aminopeptidase S (Leu, Val, Phe, Tyr preference) (EC 3.4.11.24)
Translate Function Assignments



Context on contig NC_007795 from base 1963392 to 1975322 (11931 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1891 1963392 1964111 720 +           Phage repressor protein cI locus|SAOUHSC_02084, protein_id|YP_500576.1, gi|88195767, geneID|3919770
1892 1964181 1964348 168 + 69         Phage protein locus|SAOUHSC_02085, protein_id|YP_500577.1, gi|88195768, geneID|3919771
1893 1964508 1964693 186 + 159         Phage phi 11 orf4 protein homolog locus|SAOUHSC_02086, protein_id|YP_500578.1, gi|88195769, geneID|3919772
1894 1964729 1965634 906 + 35         Phage phi 11 orf3 protein homolog locus|SAOUHSC_02087, protein_id|YP_500579.1, gi|88195770, geneID|3919773
1895 1965883 1966929 1047 + 248         Phage integrase locus|SAOUHSC_02089, protein_id|YP_500581.1, gi|88195772, geneID|3919775
1896 1966974 1968119 1146 + 44     1: 1   Hypothetical protein SAV1877 locus|SAOUHSC_02090, protein_id|YP_500582.1, gi|88195773, geneID|3919776
1897 1968909 1968379 531 - 259     1: 1   Acyl-CoA hydrolase (EC 3.1.2.20) locus|SAOUHSC_02091, protein_id|YP_500583.1, gi|88195774, geneID|3919777
1898 1970246 1968999 1248 - 89     2: 3 1   Aminopeptidase S (Leu, Val, Phe, Tyr preference) (EC 3.4.11.24) locus|SAOUHSC_02092, protein_id|YP_500584.1, gi|88195775, geneID|3919778
1899 1970458 1970258 201 - 11     2: 2 1   Hypothetical protein YfkK locus|SAOUHSC_02093, protein_id|YP_500585.1, gi|88195776, geneID|3921166
1900 1970605 1971069 465 + 146     1: 1 dlit(12193638) Low molecular weight protein tyrosine phosphatase (EC 3.1.3.48) PtpA locus|SAOUHSC_02095, protein_id|YP_500586.1, gi|88195777, geneID|3921167
1901 1971076 1971351 276 + 6     1: 1   Hypothetical protein YfkI locus|SAOUHSC_02096, protein_id|YP_500587.1, gi|88195778, geneID|3921168
1902 1971629 1972846 1218 + 277     4: 4 2 5 1   Ribonuclease BN (EC 3.1.-.-) locus|SAOUHSC_02097, protein_id|YP_500588.1, gi|88195779, geneID|3921169
1903 1973591 1972962 630 - 115     1: 1   Two component transcriptional regulator VraR locus|SAOUHSC_02098, protein_id|YP_500589.1, gi|88195780, geneID|3921170
1904 1974624 1973581 1044 - -11     1: 1 dlit(24454941)
dlit(12864861)
Cell envelope stress response system LiaFSR, sensor histidine kinase LiaS(VraS) locus|SAOUHSC_02099, protein_id|YP_500590.1, gi|88195781, geneID|3921171
1905 1975322 1974621 702 - -4     1: 1 dlit(24454941)
dlit(23070169)
Membrane protein LiaF(VraT), specific inhibitor of LiaRS(VraRS) signaling pathway locus|SAOUHSC_02100, protein_id|YP_500591.1, gi|88195782, geneID|3921172

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
CBSS-176280.1.peg.1561 OlgaZ Aminopeptidase S (Leu, Val, Phe, Tyr preference) (EC 3.4.11.24)
EC_3.4.11.-_Aminopeptidases gjo Aminopeptidase S (Leu, Val, Phe, Tyr preference) (EC 3.4.11.24)


  Protein Sequence

>fig|93061.5.peg.1898 Aminopeptidase S (Leu, Val, Phe, Tyr preference) (EC 3.4.11.24)
MTNYKEKLQQYAELLVKVGMNVQPKQPVFIRSSVETLELTHLIVEEAYHCGASDVRVVYS
DPTLKRLKFENESVEHFANHEIKSYDVEARMDYVKRGAANLALISEDPDLMDGIDSQKLQ
AFQQQNARAFKGYMESVQKNQFPWVVAAFPSKAWAKRVYPELSVEEAYIKFIDEVFDIVR
IDGNDPVENWRQHIANLSVYAQKLQQKNYHALHYVSEGTDLTVGLAKNHIWEDATSYVNG
KEQAFIANIPTEEVFTAPDRNRVDGYVTNKLPLSYNGTIIDQFKLMFKDGEIIDFSAGKG
EAVLKDLINTDEGSRRLGEVALVPDDSPISNRNTIFYNTLFDENAACHLAIGSAYAFNIQ
GGTEMTVEEKIASGLNDSNVHVDFMIGSSDLTIYGIFEDGSKELVFENGNWASTF

MD5 = a77b9a70b160d513bec9e1f851ee8f6a


  DNA Sequence

>fig|93061.5.peg.1898 Aminopeptidase S (Leu, Val, Phe, Tyr preference) (EC 3.4.11.24)
ttgactaattacaaagaaaagttacaacaatacgctgaactattagttaaggttggtatg
aatgttcaaccaaaacagccagtatttattagatcatcagtagaaacattagaattaacg
catttaattgtagaagaagcatatcattgtggcgcttcagatgtacgtgttgtatatagc
gatccaaccttaaaacgcttaaaatttgaaaatgaatctgtggaacattttgctaatcat
gagataaaatcatatgatgttgaagcgagaatggattacgttaaacgtggcgctgctaat
ttagcacttattagtgaagatcctgatttaatggatggtatcgatagccaaaaattacaa
gcatttcaacaacaaaacgcacgcgcatttaaaggatatatggaaagtgtacaaaaaaat
caatttccatgggtcgtagctgcttttccatctaaagcttgggcgaagagagtgtatcct
gaactatctgtagaagaagcatatattaagtttattgacgaggtattcgatattgtgcga
attgatggtaacgatccagttgaaaattggcgtcaacacatcgctaatttaagtgtttac
gctcaaaagttacaacaaaaaaattaccatgcgttgcattatgtatctgaaggtactgat
ttaacagtaggtttagcgaaaaatcatatctgggaagatgctacaagttatgttaacggc
aaggaacaagcttttattgctaatataccaactgaagaagtatttacagcaccagatcga
aatagagtagatggatatgttactaataaattgcctttaagttataatggcacaattatc
gatcaatttaaattgatgtttaaagatggagagattattgatttttcagctggaaaaggt
gaagcggtattgaaagatttaatcaatactgatgaaggttcaagaagattaggtgaagta
gcattagtacctgatgattcaccgatatcaaatcgtaataccattttttacaatacttta
tttgatgaaaatgcagcatgtcatttagcgattggatctgcttacgcctttaatattcaa
ggtggaacggaaatgactgttgaggaaaagattgcaagcggattaaatgattcaaatgta
catgtcgatttcatgattggtagtagtgatttgactatttatggcatattcgaagatggt
tcaaaagaactagtatttgaaaatggaaattgggcatcaacattttaa


  DNA with Flanking Sequence

>fig|93061.5.peg.1898 Aminopeptidase S (Leu, Val, Phe, Tyr preference) (EC 3.4.11.24)
ctcctaaattccagctaccagtacctcttgaatgtactttaatatcatgaatatttctgt
ctttaagtctttgtcgcatgattgcttctgccattggagaacgacatatattgccaagac
agacaaatgctacatctaccattttgattcctccaaactatgtagttatatccccatttt
atagcgactttaaacaataagaaagcagattatataaaattctattaaagtttattaaat
tgtgatactttgataacataactattattagaggtgaacattgtggctatgacaaatgaa
gagaaagtattagctattagagagaagttaaatattgttaatcaaggattattagatcct
gaaaaatataaaaatgcaaatgaagaagaattaacagatatatatgattttgttcaatca
agagaaagattgtcgccaagtgaagtgacagctattgctgacgctttaggacaattgcga
cacgaataggagtgggaattttgactaattacaaagaaaagttacaacaatacgctgaac
tattagttaaggttggtatgaatgttcaaccaaaacagccagtatttattagatcatcag
tagaaacattagaattaacgcatttaattgtagaagaagcatatcattgtggcgcttcag
atgtacgtgttgtatatagcgatccaaccttaaaacgcttaaaatttgaaaatgaatctg
tggaacattttgctaatcatgagataaaatcatatgatgttgaagcgagaatggattacg
ttaaacgtggcgctgctaatttagcacttattagtgaagatcctgatttaatggatggta
tcgatagccaaaaattacaagcatttcaacaacaaaacgcacgcgcatttaaaggatata
tggaaagtgtacaaaaaaatcaatttccatgggtcgtagctgcttttccatctaaagctt
gggcgaagagagtgtatcctgaactatctgtagaagaagcatatattaagtttattgacg
aggtattcgatattgtgcgaattgatggtaacgatccagttgaaaattggcgtcaacaca
tcgctaatttaagtgtttacgctcaaaagttacaacaaaaaaattaccatgcgttgcatt
atgtatctgaaggtactgatttaacagtaggtttagcgaaaaatcatatctgggaagatg
ctacaagttatgttaacggcaaggaacaagcttttattgctaatataccaactgaagaag
tatttacagcaccagatcgaaatagagtagatggatatgttactaataaattgcctttaa
gttataatggcacaattatcgatcaatttaaattgatgtttaaagatggagagattattg
atttttcagctggaaaaggtgaagcggtattgaaagatttaatcaatactgatgaaggtt
caagaagattaggtgaagtagcattagtacctgatgattcaccgatatcaaatcgtaata
ccattttttacaatactttatttgatgaaaatgcagcatgtcatttagcgattggatctg
cttacgcctttaatattcaaggtggaacggaaatgactgttgaggaaaagattgcaagcg
gattaaatgattcaaatgtacatgtcgatttcatgattggtagtagtgatttgactattt
atggcatattcgaagatggttcaaaagaactagtatttgaaaatggaaattgggcatcaa
cattttaataaatgttattttgaggtgctgagtaggaaatgaaacatgtatttaaaggtc
aaatacgtgattaaagtatagattgggagataaaataatgacaaatcaggacagaccaat
gaaatctatgtcagaatcaaaatgttataaaaatagacaagttttccctcaagatacgaa
tcaccatcatacaatgtttggtggtacattgatggctaatattgatgaaattgcagcaat
cacagctatgaaacatgctggtgcgcaagtagttaccgcatctacagactcagtagattt
cttaaagccgattaaaacaggggacatattacaatacgtagcgatggtttcatacgctgg
gactagttcaatggaagtggtcgttcaaattagaattgacgatgtatttaataacaagca
tgatttagctgcattaagttacttaacatttgttgcgttagatgatgaaggcaaacctaa
acatgtacctggtgtatatccagaagat


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0004177       F:aminopeptidase activity
GO:0006508       P:proteolysis
cmr|NT05SA1893 Staphylococcus aureus NCTC 8325     aminopeptidase PepS
cmr|SAUSA300_1860 Staphylococcus aureus subsp. aureus USA300-FPR3757     aminopeptidase PepS
fig|367830.3.peg.1771 Staphylococcus aureus subsp. aureus USA300 FIG   Aminopeptidase S (Leu, Val, Phe, Tyr preference) (EC 3.4.11.24)
fig|426430.8.peg.1975 Staphylococcus aureus subsp. aureus str. Newman FIG   Aminopeptidase S (Leu, Val, Phe, Tyr preference) (EC 3.4.11.24)
fig|451515.3.peg.1981 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Aminopeptidase S (Leu, Val, Phe, Tyr preference) (EC 3.4.11.24)
fig|451516.9.peg.1970 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Aminopeptidase S (Leu, Val, Phe, Tyr preference) (EC 3.4.11.24)
fig|452948.4.peg.2122 Staphylococcus aureus 930918-3 FIG   Aminopeptidase S (Leu, Val, Phe, Tyr preference) (EC 3.4.11.24)
fig|546342.3.peg.900 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Aminopeptidase S (Leu, Val, Phe, Tyr preference) (EC 3.4.11.24)
fig|546343.3.peg.1488 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Aminopeptidase S (Leu, Val, Phe, Tyr preference) (EC 3.4.11.24)
fig|553567.3.peg.536 Staphylococcus aureus A5948 FIG   Aminopeptidase S (Leu, Val, Phe, Tyr preference) (EC 3.4.11.24)
fig|553590.4.peg.1491 Staphylococcus aureus A9754 FIG   Aminopeptidase S (Leu, Val, Phe, Tyr preference) (EC 3.4.11.24)
fig|644279.4.peg.2026 Staphylococcus aureus subsp. aureus 132 FIG   Aminopeptidase S (Leu, Val, Phe, Tyr preference) (EC 3.4.11.24)
fig|93062.19.peg.1892 Staphylococcus aureus subsp. aureus COL FIG   Aminopeptidase S (Leu, Val, Phe, Tyr preference) (EC 3.4.11.24)
gb|ABD22314.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     aminopeptidase PepS
gb|EEW44297.1 Staphylococcus aureus 930918-3     aminopeptidase ampS
gi|221137914 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   aminopeptidase PepS
gi|221141452 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   aminopeptidase PepS
gi|259159237 Staphylococcus aureus 930918-3 NCBI   aminopeptidase ampS
gi|87127800 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   aminopeptidase PepS
gi|87161826 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   aminopeptidase PepS
img|637888506 Staphylococcus aureus aureus USA300 IMG   aminopeptidase PepS( EC:3.4.11.- )
kegg|saa:SAUSA300_1860 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   aminopeptidase PepS (EC:3.4.11.-)
ref|YP_494512.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   aminopeptidase PepS
ref|ZP_03562716.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   aminopeptidase PepS
ref|ZP_03565945.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   aminopeptidase PepS
tr|Q2FFL6 Staphylococcus aureus (strain USA300) TrEMBL   Aminopeptidase PepS


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search