The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93061.5.peg.1896: Staphylococcus aureus subsp. aureus NCTC 8325

This feature in The SEED Viewer

NCBI Taxonomy Id: 93061

Current Assignment: Hypothetical protein SAV1877
Translate Function Assignments



Context on contig NC_007795 from base 1961761 to 1973591 (11831 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1888 1962552 1961761 792 -           Phage antirepressor protein locus|SAOUHSC_02080, protein_id|YP_500573.1, gi|88195764, geneID|3919767
1889 1963017 1962709 309 - 156         Phage protein locus|SAOUHSC_02081, protein_id|YP_500574.1, gi|88195765, geneID|3919768
1890 1963250 1963032 219 - 14         Phage transcriptional regulator cro locus|SAOUHSC_02083, protein_id|YP_500575.1, gi|88195766, geneID|3919769
1891 1963392 1964111 720 + 141         Phage repressor protein cI locus|SAOUHSC_02084, protein_id|YP_500576.1, gi|88195767, geneID|3919770
1892 1964181 1964348 168 + 69         Phage protein locus|SAOUHSC_02085, protein_id|YP_500577.1, gi|88195768, geneID|3919771
1893 1964508 1964693 186 + 159         Phage phi 11 orf4 protein homolog locus|SAOUHSC_02086, protein_id|YP_500578.1, gi|88195769, geneID|3919772
1894 1964729 1965634 906 + 35         Phage phi 11 orf3 protein homolog locus|SAOUHSC_02087, protein_id|YP_500579.1, gi|88195770, geneID|3919773
1895 1965883 1966929 1047 + 248         Phage integrase locus|SAOUHSC_02089, protein_id|YP_500581.1, gi|88195772, geneID|3919775
1896 1966974 1968119 1146 + 44     1: 1   Hypothetical protein SAV1877 locus|SAOUHSC_02090, protein_id|YP_500582.1, gi|88195773, geneID|3919776
1897 1968909 1968379 531 - 259     1: 1   Acyl-CoA hydrolase (EC 3.1.2.20) locus|SAOUHSC_02091, protein_id|YP_500583.1, gi|88195774, geneID|3919777
1898 1970246 1968999 1248 - 89     2: 4 1   Aminopeptidase S (Leu, Val, Phe, Tyr preference) (EC 3.4.11.24) locus|SAOUHSC_02092, protein_id|YP_500584.1, gi|88195775, geneID|3919778
1899 1970458 1970258 201 - 11     2: 2 1   Hypothetical protein YfkK locus|SAOUHSC_02093, protein_id|YP_500585.1, gi|88195776, geneID|3921166
1900 1970605 1971069 465 + 146     1: 1 dlit(12193638) Low molecular weight protein tyrosine phosphatase (EC 3.1.3.48) PtpA locus|SAOUHSC_02095, protein_id|YP_500586.1, gi|88195777, geneID|3921167
1901 1971076 1971351 276 + 6     1: 1   Hypothetical protein YfkI locus|SAOUHSC_02096, protein_id|YP_500587.1, gi|88195778, geneID|3921168
1902 1971629 1972846 1218 + 277     4: 5 2 3 1   Ribonuclease BN (EC 3.1.-.-) locus|SAOUHSC_02097, protein_id|YP_500588.1, gi|88195779, geneID|3921169
1903 1973591 1972962 630 - 115     1: 1   Two component transcriptional regulator VraR locus|SAOUHSC_02098, protein_id|YP_500589.1, gi|88195780, geneID|3921170

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
CBSS-176280.1.peg.1561 OlgaZ Hypothetical protein SAV1877


  Protein Sequence

>fig|93061.5.peg.1896 Hypothetical protein SAV1877
MRNNKPKISIQNDPWEAYNDVKEHGQLTLSNIEFTTTNLCNMRCSHCAVGYTLQTVDPEP
LDMDLIYRRLDEIPNLRTMSITGGEPMFSKKSIRNVVKPLLKYAHHRGIYTQMNSNLTLP
QDRYLDIAEYIDVMHISHNWGTTDEFANVGFGAMKKQPPLKAKLKLYEQMISNARTLSEQ
GMFVSAETMLNQSTLPHLRKIHQEVVHDMKCSRHEIHPMYPADFASQLNVLTLAEMKKTI
HDILDFRDEDIWMLFGTLPVFPCLKDDEDQKLLSRLRNAKNVTTRNDPDGRSRLNVNVFT
GNVIVTDFGDETGTISNIQKDKLTDVFDKWLSSDLAKSLNCHCSEFSCLGPNVLVKNMYY
PNMDFKDNERHMHKQPQIIQF

MD5 = 12aa07ee538e37d2973acef3fa214638


  DNA Sequence

>fig|93061.5.peg.1896 Hypothetical protein SAV1877
atgcgtaataacaagcctaaaataagtattcaaaacgacccatgggaagcatataacgat
gttaaagaacatggccaattaactttaagtaacatcgaatttacaactacaaatctttgt
aatatgcgttgtagccactgtgcagttggttatactttacaaactgtcgaccccgagcct
ttagatatggacttaatttatcgtagacttgatgaaattccaaatctgcgaacgatgtct
attacaggtggcgaaccaatgttttctaaaaagtctattagaaatgttgttaaacctcta
ttaaagtatgcacatcatcgaggtatatatacacaaatgaattcaaacctaacattgcct
caagatcgttatttagatattgctgaatatatcgatgttatgcatatctcacacaactgg
ggaacaactgatgaattcgcaaatgttggctttggcgcaatgaagaagcaaccaccgtta
aaagctaagttaaaattatatgaacaaatgatttcgaatgcacgtacattatcagaacaa
ggaatgtttgtatctgcggaaacaatgctcaatcaaagtacgctaccacatttacgaaaa
atacatcaagaagtcgttcatgatatgaaatgtagcagacacgagattcaccctatgtat
ccagctgactttgcaagtcaattaaatgtgttaactctagcggaaatgaaaaagacaatt
catgatatattggatttcagagatgaagatatttggatgttatttggtactttgcctgtg
tttccatgcttaaaggatgatgaagatcaaaagttactatcacgtttaagaaatgctaaa
aatgtaacgactagaaatgacccggatggccgtagtcgtttaaatgtcaatgtatttaca
ggtaatgtaatcgtaactgatttcggagatgaaacaggtacaatttcgaatatacaaaaa
gataaattaacagatgtatttgataaatggttatcctctgatcttgctaaatcattaaat
tgtcattgttccgagtttagttgtttagggccaaatgttcttgttaaaaatatgtactat
ccgaatatggattttaaagataatgagcgtcatatgcacaaacaaccacaaattatacaa
ttttaa


  DNA with Flanking Sequence

>fig|93061.5.peg.1896 Hypothetical protein SAV1877
gaagctttagctttgcagtggaaagattacgataaaataaaaggcgaaattgacgtaaat
aagaaaatcaatttaagtaatagaaaaattgaatataatctaaaaaaagaaagctctaaa
gggataatacctgtaccaaatttaattagagagatgcttaaaaacatgtataatgaatct
tctaaaagatataaatattttgacgaaaactattttatattcgggggtttagaacctatt
agatacgttacttattcgtatcattttaaatctgtattcccgaatctaaaaatacaccat
ttaagacactcgtacgctagctatttaattaataatggtgtagatatgtatttattaatg
gaattaatgaggcattctaacattacagaaacaattcaaacgtactctcatttatatact
gataaaaaacatcaagctatgagcatatttgattaaacggtatcaaattggtatcaaata
acaattaaggagtttataaaatgcgtaataacaagcctaaaataagtattcaaaacgacc
catgggaagcatataacgatgttaaagaacatggccaattaactttaagtaacatcgaat
ttacaactacaaatctttgtaatatgcgttgtagccactgtgcagttggttatactttac
aaactgtcgaccccgagcctttagatatggacttaatttatcgtagacttgatgaaattc
caaatctgcgaacgatgtctattacaggtggcgaaccaatgttttctaaaaagtctatta
gaaatgttgttaaacctctattaaagtatgcacatcatcgaggtatatatacacaaatga
attcaaacctaacattgcctcaagatcgttatttagatattgctgaatatatcgatgtta
tgcatatctcacacaactggggaacaactgatgaattcgcaaatgttggctttggcgcaa
tgaagaagcaaccaccgttaaaagctaagttaaaattatatgaacaaatgatttcgaatg
cacgtacattatcagaacaaggaatgtttgtatctgcggaaacaatgctcaatcaaagta
cgctaccacatttacgaaaaatacatcaagaagtcgttcatgatatgaaatgtagcagac
acgagattcaccctatgtatccagctgactttgcaagtcaattaaatgtgttaactctag
cggaaatgaaaaagacaattcatgatatattggatttcagagatgaagatatttggatgt
tatttggtactttgcctgtgtttccatgcttaaaggatgatgaagatcaaaagttactat
cacgtttaagaaatgctaaaaatgtaacgactagaaatgacccggatggccgtagtcgtt
taaatgtcaatgtatttacaggtaatgtaatcgtaactgatttcggagatgaaacaggta
caatttcgaatatacaaaaagataaattaacagatgtatttgataaatggttatcctctg
atcttgctaaatcattaaattgtcattgttccgagtttagttgtttagggccaaatgttc
ttgttaaaaatatgtactatccgaatatggattttaaagataatgagcgtcatatgcaca
aacaaccacaaattatacaattttaaaaactcttaattatgcggagaagcactttatcga
taagtagtctccgcatattttaatgctattataaaataaaaaacaattaattgctggcag
tactctacttaaataataaagggcatttaataggactaatagtctataataaaaggggta
aattttaactaaaagcataaacgtgcataatcaaaaagacagattgtaggtggaatattc
gaacataacagttcaattcatccttaacaatctgtctttatatttttagtctctaatatg
ttgcacttgagctaaatattcaattgtttgtttactttcaatgcgacgtgcttttcttcg
ttcaacacgttgtggtgctgtatcataaaaccatttttcaacatcatcttctggatatac
accaggtacatgtttaggtttgccttcatcatctaacgcaacaaatgttaagtaacttaa
tgcagctaaatcatgcttgttattaaatacatcgtcaattctaatt


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003824       F:catalytic activity
GO:0051536       F:iron-sulfur cluster binding
cmr|NT05SA1891 Staphylococcus aureus NCTC 8325     radical SAM
fig|546342.3.peg.902 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Hypothetical protein SAV1877
fig|546343.3.peg.1486 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Hypothetical protein SAV1877
fig|93061.3.peg.1974 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Hypothetical protein SAV1877
gb|ABD31141.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical phage protein
gi|221137916 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   hypothetical protein SauraJK_04568
gi|221141450 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   hypothetical protein SauraJ_07398
gi|87203331 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical phage protein
gi|88195773 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_02090
img|637894716 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
kegg|sao:SAOUHSC_02090 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
ref|YP_500582.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_02090
ref|ZP_03562718.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   hypothetical protein SauraJK_04568
ref|ZP_03565943.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   hypothetical protein SauraJ_07398
tr|Q2FX16 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Conserved hypothetical phage protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search