The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93061.5.peg.1895: Staphylococcus aureus subsp. aureus NCTC 8325

This feature in The SEED Viewer

NCBI Taxonomy Id: 93061

Current Assignment: Phage integrase
Translate Function Assignments



Context on contig NC_007795 from base 1960810 to 1972846 (12037 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1885 1961031 1960810 222 -           Phage phi 11 orf10 protein homolog locus|SAOUHSC_02077, protein_id|YP_500570.1, gi|88195761, geneID|3919764
1886 1961494 1961045 450 - 13         Phage phi 11 orf9 protein homolog locus|SAOUHSC_02078, protein_id|YP_500571.1, gi|88195762, geneID|3919765
1887 1961760 1961536 225 - 41         Phage phi 11 orf8 protein homolog locus|SAOUHSC_02079, protein_id|YP_500572.1, gi|88195763, geneID|3919766
1888 1962552 1961761 792 - 0 6     Phage antirepressor protein locus|SAOUHSC_02080, protein_id|YP_500573.1, gi|88195764, geneID|3919767
1889 1963017 1962709 309 - 156         Phage protein locus|SAOUHSC_02081, protein_id|YP_500574.1, gi|88195765, geneID|3919768
1890 1963250 1963032 219 - 14         Phage transcriptional regulator cro locus|SAOUHSC_02083, protein_id|YP_500575.1, gi|88195766, geneID|3919769
1891 1963392 1964111 720 + 141 11     Phage repressor protein cI locus|SAOUHSC_02084, protein_id|YP_500576.1, gi|88195767, geneID|3919770
1892 1964181 1964348 168 + 69         Phage protein locus|SAOUHSC_02085, protein_id|YP_500577.1, gi|88195768, geneID|3919771
1893 1964508 1964693 186 + 159         Phage phi 11 orf4 protein homolog locus|SAOUHSC_02086, protein_id|YP_500578.1, gi|88195769, geneID|3919772
1894 1964729 1965634 906 + 35         Phage phi 11 orf3 protein homolog locus|SAOUHSC_02087, protein_id|YP_500579.1, gi|88195770, geneID|3919773
1895 1965883 1966929 1047 + 248       Phage integrase locus|SAOUHSC_02089, protein_id|YP_500581.1, gi|88195772, geneID|3919775
1896 1966974 1968119 1146 + 44     1: 1   Hypothetical protein SAV1877 locus|SAOUHSC_02090, protein_id|YP_500582.1, gi|88195773, geneID|3919776
1897 1968909 1968379 531 - 259     1: 1   Acyl-CoA hydrolase (EC 3.1.2.20) locus|SAOUHSC_02091, protein_id|YP_500583.1, gi|88195774, geneID|3919777
1898 1970246 1968999 1248 - 89     2: 3 1   Aminopeptidase S (Leu, Val, Phe, Tyr preference) (EC 3.4.11.24) locus|SAOUHSC_02092, protein_id|YP_500584.1, gi|88195775, geneID|3919778
1899 1970458 1970258 201 - 11     2: 2 1   Hypothetical protein YfkK locus|SAOUHSC_02093, protein_id|YP_500585.1, gi|88195776, geneID|3921166
1900 1970605 1971069 465 + 146     1: 1 dlit(12193638) Low molecular weight protein tyrosine phosphatase (EC 3.1.3.48) PtpA locus|SAOUHSC_02095, protein_id|YP_500586.1, gi|88195777, geneID|3921167
1901 1971076 1971351 276 + 6     1: 1   Hypothetical protein YfkI locus|SAOUHSC_02096, protein_id|YP_500587.1, gi|88195778, geneID|3921168
1902 1971629 1972846 1218 + 277     4: 4 2 5 1   Ribonuclease BN (EC 3.1.-.-) locus|SAOUHSC_02097, protein_id|YP_500588.1, gi|88195779, geneID|3921169

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93061.5.peg.1895 Phage integrase
MPVYKDDNTGKWYFSIRYKDVYGNNKRKMKRGFERKKDAKLAESEFIQNVKYGYSDNQPF
EYIFFDRLKNENLSARSIEKRTTEYNTHIKERFGNIPIGKITTTQCTAFRNYLLNDAGLS
VDYARSVWAGFKAVINYAKKHYKLLYDPTLSVTPIPRTKPQAKFITREEFDEKVEQITND
TSRQLTRLLFYSGLRIGEALALQWKDYDKIKGEIDVNKKINLSNRKIEYNLKKESSKGII
PVPNLIREMLKNMYNESSKRYKYFDENYFIFGGLEPIRYVTYSYHFKSVFPNLKIHHLRH
SYASYLINNGVDMYLLMELMRHSNITETIQTYSHLYTDKKHQAMSIFD

MD5 = 0583c9dbea40459cf9384e1474bfc2ae


  DNA Sequence

>fig|93061.5.peg.1895 Phage integrase
atgccagtatataaggatgataatacaggtaaatggtatttttccattagatataaagat
gtatacggtaataacaaacgaaaaatgaagcgtgggtttgaacgtaagaaagatgccaaa
ctagctgaaagcgaatttatacaaaatgttaaatatggatactcggacaatcaacccttt
gaatatatattttttgatcgtttaaaaaatgaaaatctttctgcacgctcaatagaaaag
cgaactacagaatataatactcacataaaagaaaggttcggaaatatccctattggcaaa
atcactactacgcaatgtactgctttcaggaattatttgttaaacgatgcaggtctttct
gttgactatgcacgatctgtgtgggcaggttttaaagcagttatcaattacgccaaaaag
cattacaagctcttatacgaccccacattatcggtaactcctattcccagaacaaaacca
caagctaaatttatcactcgtgaagaatttgatgaaaaagtagaacaaatcacaaatgat
acttctcgtcagctaactagactgttattttattctggtcttagaataggagaagcttta
gctttgcagtggaaagattacgataaaataaaaggcgaaattgacgtaaataagaaaatc
aatttaagtaatagaaaaattgaatataatctaaaaaaagaaagctctaaagggataata
cctgtaccaaatttaattagagagatgcttaaaaacatgtataatgaatcttctaaaaga
tataaatattttgacgaaaactattttatattcgggggtttagaacctattagatacgtt
acttattcgtatcattttaaatctgtattcccgaatctaaaaatacaccatttaagacac
tcgtacgctagctatttaattaataatggtgtagatatgtatttattaatggaattaatg
aggcattctaacattacagaaacaattcaaacgtactctcatttatatactgataaaaaa
catcaagctatgagcatatttgattaa


  DNA with Flanking Sequence

>fig|93061.5.peg.1895 Phage integrase
ttgaacaagtttgataaagatataattaaacaaacacctgattacaagaggaatataaga
acatttttaaacgaaatggaaaacaacgatttaatagaagaacatttaaaacattcagtc
aaagctgctattgaacacagaaactctattatgcatggtattaaaatcgaagagtacaat
tcgataattcaaacattatttgacgaaatagctaagctgtctaatgtatataagtctctt
aataaacagtaagcaaaatcggattcttcattacataccgaatattcatcataaacactg
actgcatcttctaagacattttttaaaattctaatgtcttcattcgttaaaactaattca
ttgaaattatgattgtttttaaatgtcataacatcacctactttttattttattatatca
catttagtacctagtactaaatttcgggtagcccgcctacccttattattttttgccaat
tttgaggagggagaagcaaaatgccagtatataaggatgataatacaggtaaatggtatt
tttccattagatataaagatgtatacggtaataacaaacgaaaaatgaagcgtgggtttg
aacgtaagaaagatgccaaactagctgaaagcgaatttatacaaaatgttaaatatggat
actcggacaatcaaccctttgaatatatattttttgatcgtttaaaaaatgaaaatcttt
ctgcacgctcaatagaaaagcgaactacagaatataatactcacataaaagaaaggttcg
gaaatatccctattggcaaaatcactactacgcaatgtactgctttcaggaattatttgt
taaacgatgcaggtctttctgttgactatgcacgatctgtgtgggcaggttttaaagcag
ttatcaattacgccaaaaagcattacaagctcttatacgaccccacattatcggtaactc
ctattcccagaacaaaaccacaagctaaatttatcactcgtgaagaatttgatgaaaaag
tagaacaaatcacaaatgatacttctcgtcagctaactagactgttattttattctggtc
ttagaataggagaagctttagctttgcagtggaaagattacgataaaataaaaggcgaaa
ttgacgtaaataagaaaatcaatttaagtaatagaaaaattgaatataatctaaaaaaag
aaagctctaaagggataatacctgtaccaaatttaattagagagatgcttaaaaacatgt
ataatgaatcttctaaaagatataaatattttgacgaaaactattttatattcgggggtt
tagaacctattagatacgttacttattcgtatcattttaaatctgtattcccgaatctaa
aaatacaccatttaagacactcgtacgctagctatttaattaataatggtgtagatatgt
atttattaatggaattaatgaggcattctaacattacagaaacaattcaaacgtactctc
atttatatactgataaaaaacatcaagctatgagcatatttgattaaacggtatcaaatt
ggtatcaaataacaattaaggagtttataaaatgcgtaataacaagcctaaaataagtat
tcaaaacgacccatgggaagcatataacgatgttaaagaacatggccaattaactttaag
taacatcgaatttacaactacaaatctttgtaatatgcgttgtagccactgtgcagttgg
ttatactttacaaactgtcgaccccgagcctttagatatggacttaatttatcgtagact
tgatgaaattccaaatctgcgaacgatgtctattacaggtggcgaaccaatgttttctaa
aaagtctattagaaatgttgttaaacctctattaaagtatgcacatcatcgaggtatata
tacacaaatgaattcaaacctaacattgcctcaagatcgttatttagatattgctgaata
tatcgatgttatgcatatctcacacaactggggaacaactgatgaattcgcaaatgttgg
ctttggc


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003677       F:DNA binding
GO:0006310       P:DNA recombination
GO:0015074       P:DNA integration
cmr|NT05SA1890 Staphylococcus aureus NCTC 8325     integrase
fig|12360.1.peg.1 Staphylococcus aureus phage phi 11 FIG   Phage integrase
fig|93061.3.peg.1973 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Phage integrase
gb|AAA32198.1 Staphylococcus phage 11     integrase (int)
gb|AAL82229.1 Staphylococcus aureus phage phi 11     integrase
gb|ABD31140.1 Staphylococcus aureus subsp. aureus NCTC 8325     integrase, phage family, putative
gi|166159 Staphylococcus phage 11 NCBI   integrase (int)
gi|18920488 Staphylococcus aureus phage phi 11 NCBI   integrase
gi|29028564 Staphylococcus phage 11 NCBI   integrase
gi|87203330 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   integrase, phage family, putative
gi|88195772 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   phage family integrase
img|637894715 Staphylococcus aureus aureus NCTC 8325 IMG   integrase, phage family, putative
img|638296996 Staphylococcus phage 11 IMG   integrase
kegg|sao:SAOUHSC_02089 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   phage family integrase
ref|NP_803254.1 Staphylococcus phage 11 RefSeq   integrase
ref|YP_500581.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   phage family integrase
tr|Q2FX17 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Integrase, phage family, putative
tr|Q38045 Staphylococcus phage phi11 (Bacteriophage phi-11) TrEMBL   Integrase


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
6 fig|93061.5.peg.1888 Phage antirepressor protein
11 fig|93061.5.peg.1891 Phage repressor protein cI


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search