The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93061.5.peg.1894: Staphylococcus aureus subsp. aureus NCTC 8325

This feature in The SEED Viewer

NCBI Taxonomy Id: 93061

Current Assignment: Phage phi 11 orf3 protein homolog
Translate Function Assignments



Context on contig NC_007795 from base 1959447 to 1971069 (11623 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1881 1959983 1959447 537 -           Phage phi 11 orf61 protein homolog locus|SAOUHSC_02073, protein_id|YP_500566.1, gi|88195757, geneID|3919760
1882 1960256 1959996 261 - 12         Phage phi 11 orf11 protein homolog locus|SAOUHSC_02074, protein_id|YP_500567.1, gi|88195758, geneID|3919761
1883 1960566 1960237 330 - -20         Phage protein locus|SAOUHSC_02075, protein_id|YP_500568.1, gi|88195759, geneID|3919762
1884 1960817 1960656 162 - 89         Phage phi 11 orf10a protein homolog locus|SAOUHSC_02076, protein_id|YP_500569.1, gi|88195760, geneID|3919763
1885 1961031 1960810 222 - -8         Phage phi 11 orf10 protein homolog locus|SAOUHSC_02077, protein_id|YP_500570.1, gi|88195761, geneID|3919764
1886 1961494 1961045 450 - 13         Phage phi 11 orf9 protein homolog locus|SAOUHSC_02078, protein_id|YP_500571.1, gi|88195762, geneID|3919765
1887 1961760 1961536 225 - 41         Phage phi 11 orf8 protein homolog locus|SAOUHSC_02079, protein_id|YP_500572.1, gi|88195763, geneID|3919766
1888 1962552 1961761 792 - 0         Phage antirepressor protein locus|SAOUHSC_02080, protein_id|YP_500573.1, gi|88195764, geneID|3919767
1889 1963017 1962709 309 - 156         Phage protein locus|SAOUHSC_02081, protein_id|YP_500574.1, gi|88195765, geneID|3919768
1890 1963250 1963032 219 - 14         Phage transcriptional regulator cro locus|SAOUHSC_02083, protein_id|YP_500575.1, gi|88195766, geneID|3919769
1891 1963392 1964111 720 + 141         Phage repressor protein cI locus|SAOUHSC_02084, protein_id|YP_500576.1, gi|88195767, geneID|3919770
1892 1964181 1964348 168 + 69         Phage protein locus|SAOUHSC_02085, protein_id|YP_500577.1, gi|88195768, geneID|3919771
1893 1964508 1964693 186 + 159         Phage phi 11 orf4 protein homolog locus|SAOUHSC_02086, protein_id|YP_500578.1, gi|88195769, geneID|3919772
1894 1964729 1965634 906 + 35         Phage phi 11 orf3 protein homolog locus|SAOUHSC_02087, protein_id|YP_500579.1, gi|88195770, geneID|3919773
1895 1965883 1966929 1047 + 248         Phage integrase locus|SAOUHSC_02089, protein_id|YP_500581.1, gi|88195772, geneID|3919775
1896 1966974 1968119 1146 + 44     1: 1   Hypothetical protein SAV1877 locus|SAOUHSC_02090, protein_id|YP_500582.1, gi|88195773, geneID|3919776
1897 1968909 1968379 531 - 259     1: 1   Acyl-CoA hydrolase (EC 3.1.2.20) locus|SAOUHSC_02091, protein_id|YP_500583.1, gi|88195774, geneID|3919777
1898 1970246 1968999 1248 - 89     2: 2 1   Aminopeptidase S (Leu, Val, Phe, Tyr preference) (EC 3.4.11.24) locus|SAOUHSC_02092, protein_id|YP_500584.1, gi|88195775, geneID|3919778
1899 1970458 1970258 201 - 11     2: 3 1   Hypothetical protein YfkK locus|SAOUHSC_02093, protein_id|YP_500585.1, gi|88195776, geneID|3921166
1900 1970605 1971069 465 + 146     1: 1 dlit(12193638) Low molecular weight protein tyrosine phosphatase (EC 3.1.3.48) PtpA locus|SAOUHSC_02095, protein_id|YP_500586.1, gi|88195777, geneID|3921167

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93061.5.peg.1894 Phage phi 11 orf3 protein homolog
MEEKQYLWRYNDIEKRMNELHKKYKELVDIFFGDVIDKNTGYFPFYSGIKYSYADLNISF
YRGLIYIHGGSEGMQAKKINISVDDVLKRTERSFEKLSEYIKSTFIFEKVIHDFQMFNLS
DLASIYNDDAIAHYYFETHSDLYLSDKSTKIYRTPNSLLENANDLPASLRKYTQLLETVN
DKDFETHIVEAYDCFMSEKRLATSLLLGRALELMCRLILNKFDKDIIKQTPDYKRNIRTF
LNEMENNDLIEEHLKHSVKAAIEHRNSIMHGIKIEEYNSIIQTLFDEIAKLSNVYKSLNK
Q

MD5 = 49082c9ca2ef7f133894bf5063f03413


  DNA Sequence

>fig|93061.5.peg.1894 Phage phi 11 orf3 protein homolog
atggaagagaaacaatacttatggagatataacgatatagaaaaaagaatgaatgaactt
cacaaaaaatataaagaattagtggatatattttttggtgatgtaatagataaaaatact
ggatacttccccttttattccggtataaaatatagctacgcagatttgaatatcagtttt
tacagaggtttaatttatattcacggtgggtcagaaggcatgcaagcgaagaaaataaat
atttctgtagatgatgttttaaaaagaacagaaagatctttcgagaagttaagtgaatat
ataaaaagtactttcattttcgaaaaagtcatacatgattttcaaatgtttaacttgagc
gatttagctagtatatacaacgacgatgcaattgcgcattattattttgaaactcattct
gacttatatttatcagataaatctacaaaaatttatcgaacacctaattctttgttagaa
aacgcaaatgatttaccggcttctttaagaaaatacactcaattattagaaacagttaat
gacaaggattttgaaactcatatagttgaagcttatgattgctttatgtctgaaaaaagg
ctagctacatcactacttttaggtagagcgctagaactaatgtgtaggctgatattgaac
aagtttgataaagatataattaaacaaacacctgattacaagaggaatataagaacattt
ttaaacgaaatggaaaacaacgatttaatagaagaacatttaaaacattcagtcaaagct
gctattgaacacagaaactctattatgcatggtattaaaatcgaagagtacaattcgata
attcaaacattatttgacgaaatagctaagctgtctaatgtatataagtctcttaataaa
cagtaa


  DNA with Flanking Sequence

>fig|93061.5.peg.1894 Phage phi 11 orf3 protein homolog
gttttaactagtggtaatcaaccattcacttatgagttacctaaagatttatcgtcacat
aatgcgcgtaaatacttggaatttatttcacaaaaaatagatggcgataagttaaattaa
ttcaaagaataaagtaacttcataaagagtacgaagaaaacgatctaatgaccgaactta
ttcttgaatatttagtaaaaaagtatgttgaagaagaatataggaaataagctcctatac
ggcgctttaacataaaaagtaaaggagaaataaaaaattatggaatcatatgaagaaatt
gagcatatacacattaacactggtagaaaaaaacttacacaagaacaaatagaagaagcc
aaagcttttatagacagtcaaggatttaaagatatgattcgagaagctaaagagtcacgt
caaagagttatggagtctaaaattaccgatagaactaaaatgtgattaatagcgcctatg
tggcgtgaggaggatgagggatggaagagaaacaatacttatggagatataacgatatag
aaaaaagaatgaatgaacttcacaaaaaatataaagaattagtggatatattttttggtg
atgtaatagataaaaatactggatacttccccttttattccggtataaaatatagctacg
cagatttgaatatcagtttttacagaggtttaatttatattcacggtgggtcagaaggca
tgcaagcgaagaaaataaatatttctgtagatgatgttttaaaaagaacagaaagatctt
tcgagaagttaagtgaatatataaaaagtactttcattttcgaaaaagtcatacatgatt
ttcaaatgtttaacttgagcgatttagctagtatatacaacgacgatgcaattgcgcatt
attattttgaaactcattctgacttatatttatcagataaatctacaaaaatttatcgaa
cacctaattctttgttagaaaacgcaaatgatttaccggcttctttaagaaaatacactc
aattattagaaacagttaatgacaaggattttgaaactcatatagttgaagcttatgatt
gctttatgtctgaaaaaaggctagctacatcactacttttaggtagagcgctagaactaa
tgtgtaggctgatattgaacaagtttgataaagatataattaaacaaacacctgattaca
agaggaatataagaacatttttaaacgaaatggaaaacaacgatttaatagaagaacatt
taaaacattcagtcaaagctgctattgaacacagaaactctattatgcatggtattaaaa
tcgaagagtacaattcgataattcaaacattatttgacgaaatagctaagctgtctaatg
tatataagtctcttaataaacagtaagcaaaatcggattcttcattacataccgaatatt
catcataaacactgactgcatcttctaagacattttttaaaattctaatgtcttcattcg
ttaaaactaattcattgaaattatgattgtttttaaatgtcataacatcacctacttttt
attttattatatcacatttagtacctagtactaaatttcgggtagcccgcctacccttat
tattttttgccaattttgaggagggagaagcaaaatgccagtatataaggatgataatac
aggtaaatggtatttttccattagatataaagatgtatacggtaataacaaacgaaaaat
gaagcgtgggtttgaacgtaagaaagatgccaaactagctgaaagcgaatttatacaaaa
tgttaaatatggatactcggacaatcaaccctttgaatatatattttttgatcgtttaaa
aaatgaaaatctttctgcacgctcaatagaaaagcgaactacagaa


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT05SA1889 Staphylococcus aureus NCTC 8325     conserved hypothetical protein
fig|12360.1.peg.3 Staphylococcus aureus phage phi 11 FIG   Phage phi 11 orf3 protein homolog
fig|320834.3.peg.36 Bacteriophage 69 FIG   Phage phi 11 orf3 protein homolog
fig|53369.2.peg.3 Siphoviridae Staphylococcus phage 80alpha FIG   Phage phi 11 orf3 protein homolog
fig|585152.3.peg.1842 Staphylococcus aureus subsp. aureus D139 FIG   Phage phi 11 orf3 protein homolog
fig|93061.3.peg.1971 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Phage phi 11 orf3 protein homolog
gb|AAL82231.1 Staphylococcus aureus phage phi 11     PV83 orf 3-like protein
gb|AAX90768.1 Bacteriophage 69     ORF013
gb|ABD31138.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical phage protein
gb|ABF71574.1 Staphylococcus phage 80alpha     hypothetical protein
gi|103058631 Staphylococcus phage 80alpha NCBI   hypothetical protein
gi|148717845 Staphylococcus phage 80alpha NCBI   hypothetical protein SPV-80A_gp03
gi|18920490 Staphylococcus aureus phage phi 11 NCBI   PV83 orf 3-like protein
gi|29028566 Staphylococcus phage 11 NCBI   PV83 orf 3-like protein
gi|62635657 Bacteriophage 69 NCBI   ORF013
gi|66395306 Staphylococcus phage 69 NCBI   ORF013
gi|87203328 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical phage protein
gi|88195770 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_02087
img|637894713 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|638296998 Staphylococcus phage 11 IMG   PV83 orf 3-like protein
img|638314019 Bacteriophage 69 IMG   ORF013
img|641208666 Staphylococcus phage 80alpha IMG   hypothetical protein
kegg|sao:SAOUHSC_02087 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
ref|NP_803256.1 Staphylococcus phage 11 RefSeq   PV83 orf 3-like protein
ref|YP_001285317.1 Staphylococcus phage 80alpha RefSeq   hypothetical protein SPV-80A_gp03
ref|YP_239600.1 Staphylococcus phage 69 RefSeq   ORF013
ref|YP_500579.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_02087
tr|A4ZF69 Staphylococcus phage 80alpha TrEMBL   Putative uncharacterized protein
tr|Q2FX19 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Conserved hypothetical phage protein
tr|Q4ZDS6 Staphylococcus phage 69 TrEMBL   ORF013
tr|Q8SDX4 Staphylococcus phage phi11 (Bacteriophage phi-11) TrEMBL   PV83 orf 3-like protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search