The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93061.5.peg.1893: Staphylococcus aureus subsp. aureus NCTC 8325

This feature in The SEED Viewer

NCBI Taxonomy Id: 93061

Current Assignment: Phage phi 11 orf4 protein homolog
Translate Function Assignments



Context on contig NC_007795 from base 1959447 to 1970246 (10800 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1881 1959983 1959447 537 -           Phage phi 11 orf61 protein homolog locus|SAOUHSC_02073, protein_id|YP_500566.1, gi|88195757, geneID|3919760
1882 1960256 1959996 261 - 12         Phage phi 11 orf11 protein homolog locus|SAOUHSC_02074, protein_id|YP_500567.1, gi|88195758, geneID|3919761
1883 1960566 1960237 330 - -20         Phage protein locus|SAOUHSC_02075, protein_id|YP_500568.1, gi|88195759, geneID|3919762
1884 1960817 1960656 162 - 89         Phage phi 11 orf10a protein homolog locus|SAOUHSC_02076, protein_id|YP_500569.1, gi|88195760, geneID|3919763
1885 1961031 1960810 222 - -8         Phage phi 11 orf10 protein homolog locus|SAOUHSC_02077, protein_id|YP_500570.1, gi|88195761, geneID|3919764
1886 1961494 1961045 450 - 13         Phage phi 11 orf9 protein homolog locus|SAOUHSC_02078, protein_id|YP_500571.1, gi|88195762, geneID|3919765
1887 1961760 1961536 225 - 41         Phage phi 11 orf8 protein homolog locus|SAOUHSC_02079, protein_id|YP_500572.1, gi|88195763, geneID|3919766
1888 1962552 1961761 792 - 0         Phage antirepressor protein locus|SAOUHSC_02080, protein_id|YP_500573.1, gi|88195764, geneID|3919767
1889 1963017 1962709 309 - 156         Phage protein locus|SAOUHSC_02081, protein_id|YP_500574.1, gi|88195765, geneID|3919768
1890 1963250 1963032 219 - 14         Phage transcriptional regulator cro locus|SAOUHSC_02083, protein_id|YP_500575.1, gi|88195766, geneID|3919769
1891 1963392 1964111 720 + 141         Phage repressor protein cI locus|SAOUHSC_02084, protein_id|YP_500576.1, gi|88195767, geneID|3919770
1892 1964181 1964348 168 + 69         Phage protein locus|SAOUHSC_02085, protein_id|YP_500577.1, gi|88195768, geneID|3919771
1893 1964508 1964693 186 + 159         Phage phi 11 orf4 protein homolog locus|SAOUHSC_02086, protein_id|YP_500578.1, gi|88195769, geneID|3919772
1894 1964729 1965634 906 + 35         Phage phi 11 orf3 protein homolog locus|SAOUHSC_02087, protein_id|YP_500579.1, gi|88195770, geneID|3919773
1895 1965883 1966929 1047 + 248         Phage integrase locus|SAOUHSC_02089, protein_id|YP_500581.1, gi|88195772, geneID|3919775
1896 1966974 1968119 1146 + 44     1: 1   Hypothetical protein SAV1877 locus|SAOUHSC_02090, protein_id|YP_500582.1, gi|88195773, geneID|3919776
1897 1968909 1968379 531 - 259     1: 1   Acyl-CoA hydrolase (EC 3.1.2.20) locus|SAOUHSC_02091, protein_id|YP_500583.1, gi|88195774, geneID|3919777
1898 1970246 1968999 1248 - 89     2: 2 1   Aminopeptidase S (Leu, Val, Phe, Tyr preference) (EC 3.4.11.24) locus|SAOUHSC_02092, protein_id|YP_500584.1, gi|88195775, geneID|3919778

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93061.5.peg.1893 Phage phi 11 orf4 protein homolog
MESYEEIEHIHINTGRKKLTQEQIEEAKAFIDSQGFKDMIREAKESRQRVMESKITDRTK
M

MD5 = 035dd621c3a554e23dfb0c0efcd86046


  DNA Sequence

>fig|93061.5.peg.1893 Phage phi 11 orf4 protein homolog
atggaatcatatgaagaaattgagcatatacacattaacactggtagaaaaaaacttaca
caagaacaaatagaagaagccaaagcttttatagacagtcaaggatttaaagatatgatt
cgagaagctaaagagtcacgtcaaagagttatggagtctaaaattaccgatagaactaaa
atgtga


  DNA with Flanking Sequence

>fig|93061.5.peg.1893 Phage phi 11 orf4 protein homolog
tatgcgaagactatattaatttggtatctctaaatccgaagtatgatgatatcaaagtcg
cttcgtttagtaatattaaagtaatgggcaaagttgtattgtgattaatagcgcctatat
ggcactttaatataaaagacgtctatttcagcagtgtttaaaaggagtttataatgaaaa
taactaattgcaaaataaaaaaagaaactatagtatatgaagttttaactagtggtaatc
aaccattcacttatgagttacctaaagatttatcgtcacataatgcgcgtaaatacttgg
aatttatttcacaaaaaatagatggcgataagttaaattaattcaaagaataaagtaact
tcataaagagtacgaagaaaacgatctaatgaccgaacttattcttgaatatttagtaaa
aaagtatgttgaagaagaatataggaaataagctcctatacggcgctttaacataaaaag
taaaggagaaataaaaaattatggaatcatatgaagaaattgagcatatacacattaaca
ctggtagaaaaaaacttacacaagaacaaatagaagaagccaaagcttttatagacagtc
aaggatttaaagatatgattcgagaagctaaagagtcacgtcaaagagttatggagtcta
aaattaccgatagaactaaaatgtgattaatagcgcctatgtggcgtgaggaggatgagg
gatggaagagaaacaatacttatggagatataacgatatagaaaaaagaatgaatgaact
tcacaaaaaatataaagaattagtggatatattttttggtgatgtaatagataaaaatac
tggatacttccccttttattccggtataaaatatagctacgcagatttgaatatcagttt
ttacagaggtttaatttatattcacggtgggtcagaaggcatgcaagcgaagaaaataaa
tatttctgtagatgatgttttaaaaagaacagaaagatctttcgagaagttaagtgaata
tataaaaagtactttcattttcgaaaaagtcatacatgattttcaaatgtttaacttgag
cgatttagctagtatatacaacgacgatgcaattgcgcattattattttgaaactcattc
tgacttatatttatcagataaatctacaaaaatttatcgaacacct


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT05SA1888 Staphylococcus aureus NCTC 8325     conserved hypothetical protein
fig|12360.1.peg.4 Staphylococcus aureus phage phi 11 FIG   Phage phi 11 orf4 protein homolog
fig|53369.2.peg.4 Siphoviridae Staphylococcus phage 80alpha FIG   Phage phi 11 orf4 protein homolog
fig|93061.3.peg.1970 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Phage phi 11 orf4 protein homolog
gb|AAL82232.1 Staphylococcus aureus phage phi 11     PV83 orf 4-like protein
gb|ABD31137.1 Staphylococcus aureus subsp. aureus NCTC 8325     PV83 orf 4-like protein-related protein
gb|ABF71575.1 Staphylococcus phage 80alpha     hypothetical protein
gi|103058632 Staphylococcus phage 80alpha NCBI   hypothetical protein
gi|148717846 Staphylococcus phage 80alpha NCBI   hypothetical protein SPV-80A_gp04
gi|18920491 Staphylococcus aureus phage phi 11 NCBI   PV83 orf 4-like protein
gi|29028567 Staphylococcus phage 11 NCBI   PV83 orf 4-like protein
gi|87203327 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   PV83 orf 4-like protein-related protein
gi|88195769 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   PV83 orf 4-like protein-related protein
img|637894712 Staphylococcus aureus aureus NCTC 8325 IMG   PV83 orf 4-like protein-related protein
img|638296999 Staphylococcus phage 11 IMG   PV83 orf 4-like protein
img|641208667 Staphylococcus phage 80alpha IMG   hypothetical protein
kegg|sao:SAOUHSC_02086 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   PV83 orf 4-like protein-related protein
ref|NP_803257.1 Staphylococcus phage 11 RefSeq   PV83 orf 4-like protein
ref|YP_001285318.1 Staphylococcus phage 80alpha RefSeq   hypothetical protein SPV-80A_gp04
ref|YP_500578.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   PV83 orf 4-like protein-related protein
tr|A4ZF70 Staphylococcus phage 80alpha TrEMBL   Putative uncharacterized protein
tr|Q2FX20 Staphylococcus aureus (strain NCTC 8325) TrEMBL   PV83 orf 4-like protein-related protein
tr|Q8SDX3 Staphylococcus phage phi11 (Bacteriophage phi-11) TrEMBL   PV83 orf 4-like protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search