The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93061.5.peg.1890: Staphylococcus aureus subsp. aureus NCTC 8325

This feature in The SEED Viewer

NCBI Taxonomy Id: 93061

Current Assignment: Phage transcriptional regulator cro
Translate Function Assignments



Context on contig NC_007795 from base 1957378 to 1968119 (10742 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1878 1958070 1957378 693 -           Phage phi 11 orf14 protein homolog locus|SAOUHSC_02070, protein_id|YP_500563.1, gi|88195754, geneID|3919757
1879 1958637 1958083 555 - 12         Phage ssDNA binding protein locus|SAOUHSC_02071, protein_id|YP_500564.1, gi|88195755, geneID|3919758
1880 1959446 1958667 780 - 29         Phage phi 11 orf12 protein homolog locus|SAOUHSC_02072, protein_id|YP_500565.1, gi|88195756, geneID|3919759
1881 1959983 1959447 537 - 0         Phage phi 11 orf61 protein homolog locus|SAOUHSC_02073, protein_id|YP_500566.1, gi|88195757, geneID|3919760
1882 1960256 1959996 261 - 12         Phage phi 11 orf11 protein homolog locus|SAOUHSC_02074, protein_id|YP_500567.1, gi|88195758, geneID|3919761
1883 1960566 1960237 330 - -20         Phage protein locus|SAOUHSC_02075, protein_id|YP_500568.1, gi|88195759, geneID|3919762
1884 1960817 1960656 162 - 89         Phage phi 11 orf10a protein homolog locus|SAOUHSC_02076, protein_id|YP_500569.1, gi|88195760, geneID|3919763
1885 1961031 1960810 222 - -8         Phage phi 11 orf10 protein homolog locus|SAOUHSC_02077, protein_id|YP_500570.1, gi|88195761, geneID|3919764
1886 1961494 1961045 450 - 13         Phage phi 11 orf9 protein homolog locus|SAOUHSC_02078, protein_id|YP_500571.1, gi|88195762, geneID|3919765
1887 1961760 1961536 225 - 41         Phage phi 11 orf8 protein homolog locus|SAOUHSC_02079, protein_id|YP_500572.1, gi|88195763, geneID|3919766
1888 1962552 1961761 792 - 0         Phage antirepressor protein locus|SAOUHSC_02080, protein_id|YP_500573.1, gi|88195764, geneID|3919767
1889 1963017 1962709 309 - 156         Phage protein locus|SAOUHSC_02081, protein_id|YP_500574.1, gi|88195765, geneID|3919768
1890 1963250 1963032 219 - 14         Phage transcriptional regulator cro locus|SAOUHSC_02083, protein_id|YP_500575.1, gi|88195766, geneID|3919769
1891 1963392 1964111 720 + 141         Phage repressor protein cI locus|SAOUHSC_02084, protein_id|YP_500576.1, gi|88195767, geneID|3919770
1892 1964181 1964348 168 + 69         Phage protein locus|SAOUHSC_02085, protein_id|YP_500577.1, gi|88195768, geneID|3919771
1893 1964508 1964693 186 + 159         Phage phi 11 orf4 protein homolog locus|SAOUHSC_02086, protein_id|YP_500578.1, gi|88195769, geneID|3919772
1894 1964729 1965634 906 + 35         Phage phi 11 orf3 protein homolog locus|SAOUHSC_02087, protein_id|YP_500579.1, gi|88195770, geneID|3919773
1895 1965883 1966929 1047 + 248         Phage integrase locus|SAOUHSC_02089, protein_id|YP_500581.1, gi|88195772, geneID|3919775
1896 1966974 1968119 1146 + 44     1: 1   Hypothetical protein SAV1877 locus|SAOUHSC_02090, protein_id|YP_500582.1, gi|88195773, geneID|3919776

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93061.5.peg.1890 Phage transcriptional regulator cro
MQWNLIKLRKERKCTQEDLANLLNISTEGYRLKELGKHQFKNDEMFIIADFFDENIGDIF
LPTKYTKRKQTS

MD5 = eeabd551ecbd43ed27c44f09e166aae5


  DNA Sequence

>fig|93061.5.peg.1890 Phage transcriptional regulator cro
atgcaatggaatttaataaagttgagaaaagaaagaaagtgtactcaagaagatttagca
aacctcttgaatatatcaactgaaggttatcgtttaaaagaattaggaaagcatcaattt
aagaatgatgagatgtttattatcgctgatttttttgacgaaaatattggagatattttt
ttacccacaaagtacacgaaacgcaaacaaacatcttaa


  DNA with Flanking Sequence

>fig|93061.5.peg.1890 Phage transcriptional regulator cro
actagtttagactctttatattcatctatagaagtgactttattctgttcatctaattgc
tcatttgcgtagttaagtacgttttcttggcggggaggtgtgagtttgttgtatatggaa
gtgatgtcgttttttttattatttcttgtaggaaacaaatcatcgatactgatatttaaa
atatgagcaatttcaaacaaatcatcttgtttaggagttctgtaccctgtctcataattt
gaaatagtagcttttttagtgttgagtttttctccaagttgatcttgagttaagttcaat
ttggttctatagtatctgattttattgcctataaatttcgctaattcttttttatccatt
ttcttacctccttaaatttacctatagtataacccaattatttttggtattcaacaaaaa
aatacacgaaaagcaaacttttatgttgactcaagtacacgtatcgtgtatagtaggttt
tgtaagcgggaggtgacaacatgcaatggaatttaataaagttgagaaaagaaagaaagt
gtactcaagaagatttagcaaacctcttgaatatatcaactgaaggttatcgtttaaaag
aattaggaaagcatcaatttaagaatgatgagatgtttattatcgctgatttttttgacg
aaaatattggagatatttttttacccacaaagtacacgaaacgcaaacaaacatcttaaa
ggagacataacaaatgcaagaccaatcattaaaattagtaaaactacaactaaaatatca
taacctttcaggacaaattgaagcttatgataaatcacttaaagaaataagatacactcg
agatcttttcaacaaacatctaagcatgaataacgaagacgcatttgctggtttggaaat
ggtagaagatgaaattactaaaaagctacgaagtgctatcaaagagttccaaaaagtagt
gaaagcgttagacaagcttaacggtgttgaaagcgataacaaagttactgatttaacaga
gtggcggaaagtgaatcagtaacattcacttcttaatataaccacgcttatcaacatcca
cattgagcagatgtgagcgagagctggcgatgatatgagccgcgtttaaatacattcgat
agtcattgcgataaccgtctgctgaatgtgggtgttgaggaaaaaggaggatactcaaat
gcaagcattacaaacattt


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0043565       F:sequence-specific DNA binding
cmr|NT05SA1885 Staphylococcus aureus NCTC 8325     conserved hypothetical protein
fig|12360.1.peg.6 Staphylococcus aureus phage phi 11 FIG   Phage transcriptional regulator cro
fig|320834.3.peg.39 Bacteriophage 69 FIG   Phage transcriptional regulator cro
fig|320835.3.peg.63 Bacteriophage 53 FIG   Phage transcriptional regulator cro
fig|320837.3.peg.43 Bacteriophage 42e FIG   Phage transcriptional regulator cro
fig|387908.2.peg.5 Siphoviridae Staphylococcus aureus phage phiNM2 FIG   Phage transcriptional regulator cro
fig|426430.8.peg.1078 Staphylococcus aureus subsp. aureus str. Newman FIG   Phage transcriptional regulator cro
fig|452948.4.peg.2767 Staphylococcus aureus 930918-3 FIG   Phage transcriptional regulator cro
fig|585147.3.peg.1544 Staphylococcus aureus subsp. aureus A017934/97 FIG   Phage transcriptional regulator cro
fig|680649.3.peg.2625 Staphylococcus aureus subsp. aureus MR1 FIG   Phage transcriptional regulator cro
fig|93061.3.peg.1967 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Phage transcriptional regulator cro
gb|AAL82234.1 Staphylococcus aureus phage phi 11     cro-like repressor
gb|AAX90808.1 Bacteriophage 69     ORF069
gb|AAX90886.1 Bacteriophage 53     ORF073
gb|AAX91173.1 Bacteriophage 42e     ORF076
gb|ABD31134.1 Staphylococcus aureus subsp. aureus NCTC 8325     bacteriophage L54a, Cro-related protein
gb|ABF73099.1 Staphylococcus aureus phage phiNM2     cro-like repressor
gi|104641721 Staphylococcus aureus phage phiNM2 NCBI   cro-like repressor
gi|18920493 Staphylococcus aureus phage phi 11 NCBI   cro-like repressor
gi|29028569 Staphylococcus phage 11 NCBI   cro-like repressor
gi|62635697 Bacteriophage 69 NCBI   ORF069
gi|62635775 Bacteriophage 53 NCBI   ORF073
gi|62636062 Bacteriophage 42e NCBI   ORF076
gi|66395346 Staphylococcus phage 69 NCBI   ORF069
gi|66395425 Staphylococcus phage 53 NCBI   ORF073
gi|66395569 Staphylococcus phage 42E NCBI   ORF076
gi|87203324 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   bacteriophage L54a, Cro-related protein
gi|88195766 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   bacteriophage L54a, Cro-related protein
img|637894709 Staphylococcus aureus aureus NCTC 8325 IMG   bacteriophage L54a, Cro-related protein
img|638297001 Staphylococcus phage 11 IMG   cro-like repressor
img|638314022 Bacteriophage 69 IMG   ORF069
img|638314103 Bacteriophage 53 IMG   ORF073
img|638314314 Bacteriophage 42e IMG   ORF076
kegg|sao:SAOUHSC_02083 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   bacteriophage L54a, Cro-related protein
ref|NP_803259.1 Staphylococcus phage 11 RefSeq   cro-like repressor
ref|YP_239603.1 Staphylococcus phage 69 RefSeq   ORF069
ref|YP_239684.1 Staphylococcus phage 53 RefSeq   ORF073
ref|YP_239895.1 Staphylococcus phage 42E RefSeq   ORF076
ref|YP_500575.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   bacteriophage L54a, Cro-related protein
tr|A0EWP0 Staphylococcus aureus phage phiNM2 TrEMBL   Cro-like repressor
tr|Q2FX23 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Bacteriophage L54a, Cro-related protein
tr|Q4ZCY1 Staphylococcus phage 42E TrEMBL   ORF076
tr|Q4ZDJ2 Staphylococcus phage 53 TrEMBL   ORF073
tr|Q4ZDS3 Staphylococcus phage 69 TrEMBL   ORF069
tr|Q8SDX1 Staphylococcus phage phi11 (Bacteriophage phi-11) TrEMBL   Cro-like repressor


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search