The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93061.5.peg.1889: Staphylococcus aureus subsp. aureus NCTC 8325

This feature in The SEED Viewer

NCBI Taxonomy Id: 93061

Current Assignment: Phage protein
Translate Function Assignments



Context on contig NC_007795 from base 1957378 to 1968119 (10742 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1878 1958070 1957378 693 -           Phage phi 11 orf14 protein homolog locus|SAOUHSC_02070, protein_id|YP_500563.1, gi|88195754, geneID|3919757
1879 1958637 1958083 555 - 12         Phage ssDNA binding protein locus|SAOUHSC_02071, protein_id|YP_500564.1, gi|88195755, geneID|3919758
1880 1959446 1958667 780 - 29         Phage phi 11 orf12 protein homolog locus|SAOUHSC_02072, protein_id|YP_500565.1, gi|88195756, geneID|3919759
1881 1959983 1959447 537 - 0         Phage phi 11 orf61 protein homolog locus|SAOUHSC_02073, protein_id|YP_500566.1, gi|88195757, geneID|3919760
1882 1960256 1959996 261 - 12         Phage phi 11 orf11 protein homolog locus|SAOUHSC_02074, protein_id|YP_500567.1, gi|88195758, geneID|3919761
1883 1960566 1960237 330 - -20         Phage protein locus|SAOUHSC_02075, protein_id|YP_500568.1, gi|88195759, geneID|3919762
1884 1960817 1960656 162 - 89         Phage phi 11 orf10a protein homolog locus|SAOUHSC_02076, protein_id|YP_500569.1, gi|88195760, geneID|3919763
1885 1961031 1960810 222 - -8         Phage phi 11 orf10 protein homolog locus|SAOUHSC_02077, protein_id|YP_500570.1, gi|88195761, geneID|3919764
1886 1961494 1961045 450 - 13         Phage phi 11 orf9 protein homolog locus|SAOUHSC_02078, protein_id|YP_500571.1, gi|88195762, geneID|3919765
1887 1961760 1961536 225 - 41         Phage phi 11 orf8 protein homolog locus|SAOUHSC_02079, protein_id|YP_500572.1, gi|88195763, geneID|3919766
1888 1962552 1961761 792 - 0         Phage antirepressor protein locus|SAOUHSC_02080, protein_id|YP_500573.1, gi|88195764, geneID|3919767
1889 1963017 1962709 309 - 156         Phage protein locus|SAOUHSC_02081, protein_id|YP_500574.1, gi|88195765, geneID|3919768
1890 1963250 1963032 219 - 14         Phage transcriptional regulator cro locus|SAOUHSC_02083, protein_id|YP_500575.1, gi|88195766, geneID|3919769
1891 1963392 1964111 720 + 141         Phage repressor protein cI locus|SAOUHSC_02084, protein_id|YP_500576.1, gi|88195767, geneID|3919770
1892 1964181 1964348 168 + 69         Phage protein locus|SAOUHSC_02085, protein_id|YP_500577.1, gi|88195768, geneID|3919771
1893 1964508 1964693 186 + 159         Phage phi 11 orf4 protein homolog locus|SAOUHSC_02086, protein_id|YP_500578.1, gi|88195769, geneID|3919772
1894 1964729 1965634 906 + 35         Phage phi 11 orf3 protein homolog locus|SAOUHSC_02087, protein_id|YP_500579.1, gi|88195770, geneID|3919773
1895 1965883 1966929 1047 + 248         Phage integrase locus|SAOUHSC_02089, protein_id|YP_500581.1, gi|88195772, geneID|3919775
1896 1966974 1968119 1146 + 44     1: 1   Hypothetical protein SAV1877 locus|SAOUHSC_02090, protein_id|YP_500582.1, gi|88195773, geneID|3919776

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93061.5.peg.1889 Phage protein
MQDQSLKLVKLQLKYHNLSGQIEAYDKSLKEIRYTRDLFNKHLSMNNEDAFAGLEMVEDE
ITKKLRSAIKEFQKVVKALDKLNGVESDNKVTDLTEWRKVNQ

MD5 = 10806fa918d78ea3235e406adb73c1a5


  DNA Sequence

>fig|93061.5.peg.1889 Phage protein
atgcaagaccaatcattaaaattagtaaaactacaactaaaatatcataacctttcagga
caaattgaagcttatgataaatcacttaaagaaataagatacactcgagatcttttcaac
aaacatctaagcatgaataacgaagacgcatttgctggtttggaaatggtagaagatgaa
attactaaaaagctacgaagtgctatcaaagagttccaaaaagtagtgaaagcgttagac
aagcttaacggtgttgaaagcgataacaaagttactgatttaacagagtggcggaaagtg
aatcagtaa


  DNA with Flanking Sequence

>fig|93061.5.peg.1889 Phage protein
ataatttgaaatagtagcttttttagtgttgagtttttctccaagttgatcttgagttaa
gttcaatttggttctatagtatctgattttattgcctataaatttcgctaattctttttt
atccattttcttacctccttaaatttacctatagtataacccaattatttttggtattca
acaaaaaaatacacgaaaagcaaacttttatgttgactcaagtacacgtatcgtgtatag
taggttttgtaagcgggaggtgacaacatgcaatggaatttaataaagttgagaaaagaa
agaaagtgtactcaagaagatttagcaaacctcttgaatatatcaactgaaggttatcgt
ttaaaagaattaggaaagcatcaatttaagaatgatgagatgtttattatcgctgatttt
tttgacgaaaatattggagatatttttttacccacaaagtacacgaaacgcaaacaaaca
tcttaaaggagacataacaaatgcaagaccaatcattaaaattagtaaaactacaactaa
aatatcataacctttcaggacaaattgaagcttatgataaatcacttaaagaaataagat
acactcgagatcttttcaacaaacatctaagcatgaataacgaagacgcatttgctggtt
tggaaatggtagaagatgaaattactaaaaagctacgaagtgctatcaaagagttccaaa
aagtagtgaaagcgttagacaagcttaacggtgttgaaagcgataacaaagttactgatt
taacagagtggcggaaagtgaatcagtaacattcacttcttaatataaccacgcttatca
acatccacattgagcagatgtgagcgagagctggcgatgatatgagccgcgtttaaatac
attcgatagtcattgcgataaccgtctgctgaatgtgggtgttgaggaaaaaggaggata
ctcaaatgcaagcattacaaacatttaattttaaagagctaccagtaagaacagtagaaa
ttgaaaacgaaccttattttgtaggaaaagatattgctgagattttaggatatgcaagat
cagacaatgccattagaaatcatgttgatagcgaggacaaactgacgcaccaatttagtg
catcaggtcaaaacagaaatatgatcattatcaacgaatcaggattatacagtctaatct
tcgatgcttctaaacaaagcaaaaacgaaaaaattagagaaaccgctagaaaattcaaac
gctgggtaacatcagatgtcctaccagctattcgcaaacacggtatata


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT05SA1884 Staphylococcus aureus NCTC 8325     77ORF046
cmr|SACOL0323 Staphylococcus aureus subsp. aureus COL     hypothetical protein
fig|320837.3.peg.44 Bacteriophage 42e FIG   Phage protein
fig|585147.3.peg.1543 Staphylococcus aureus subsp. aureus A017934/97 FIG   Phage protein
fig|585161.3.peg.1843 Staphylococcus aureus subsp. aureus WW2703/97 FIG   Phage protein
fig|93061.3.peg.1966 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Phage protein
fig|93062.19.peg.315 Staphylococcus aureus subsp. aureus COL FIG   Phage protein
fig|93062.4.peg.782 Staphylococcus aureus subsp. aureus COL FIG   Phage protein
gb|AAW37530.1 Staphylococcus aureus subsp. aureus COL     hypothetical protein SACOL0323
gb|AAX91159.1 Bacteriophage 42e     ORF049
gb|ABD31133.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical phage protein
gi|57285436 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL0323
gi|57651250 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL0323
gi|62636048 Bacteriophage 42e NCBI   ORF049
gi|66395555 Staphylococcus phage 42E NCBI   ORF049
gi|87203323 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical phage protein
gi|88195765 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_02081
img|637151098 Staphylococcus aureus aureus COL IMG   hypothetical protein
img|637894708 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|638314315 Bacteriophage 42e IMG   ORF049
kegg|sac:SACOL0323 Staphylococcus aureus subsp. aureus COL KEGG   hypothetical protein
kegg|sao:SAOUHSC_02081 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
ref|YP_185215.1 Staphylococcus aureus subsp. aureus COL RefSeq   hypothetical protein SACOL0323
ref|YP_239896.1 Staphylococcus phage 42E RefSeq   ORF049
ref|YP_500574.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_02081
tr|Q2FX24 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Conserved hypothetical phage protein
tr|Q4ZCY0 Staphylococcus phage 42E TrEMBL   ORF049
tr|Q5HJ42 Staphylococcus aureus (strain COL) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


Tool Description
General Tools
Psi-Blast NCBI's psi-blast is used to locate distant similarities
Transmembrane Predictions
TMpred Tool for Predicting Transmembrane regions
TMHMM Prediction of transmembrane helices in proteins
Protein Signals for Gram negative bacteria
Gram negative PSORT Prediction of protein localization sites
Gram negative SignalP Predicts the presence and location of signal peptide cleavage sites
Protein Signals for Gram positive bacteria
Gram positive PSORT Prediction of protein localization sites
Gram positive SignalP Predicts the presence and location of signal peptide cleavage sites
Other useful tools
LipoP Prediction of lipoproteins and signal peptides in Gram negative bacteria
Radar Rapid Automatic Detection and Alignment of Repeats in protein sequences
PPSearch Search for protein motifs against all patterns stored in the PROSITE pattern database
Gram negative CELLO Subcellular localization predictor at National Chiao Tung University
Gram positive CELLO Subcellular localization predictor at National Chiao Tung University
ProDom A comprehensive set of protein domain families automatically generated from the SWISS-PROT and TrEMBL sequence databases
PDB An Information Portal to Biological Macromolecular Structures
For Specific Organisms
RNAFold The RNAfold web server will predict secondary structures of single stranded RNA or DNA sequences.

< Hide tool descriptions


FIG search