The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93061.5.peg.1888: Staphylococcus aureus subsp. aureus NCTC 8325

This feature in The SEED Viewer

NCBI Taxonomy Id: 93061

Current Assignment: Phage antirepressor protein
Translate Function Assignments



Context on contig NC_007795 from base 1956600 to 1968119 (11520 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1877 1957406 1956600 807 -           Phage replication initiation protein locus|SAOUHSC_02069, protein_id|YP_500562.1, gi|88195753, geneID|3919756
1878 1958070 1957378 693 - -29         Phage phi 11 orf14 protein homolog locus|SAOUHSC_02070, protein_id|YP_500563.1, gi|88195754, geneID|3919757
1879 1958637 1958083 555 - 12         Phage ssDNA binding protein locus|SAOUHSC_02071, protein_id|YP_500564.1, gi|88195755, geneID|3919758
1880 1959446 1958667 780 - 29         Phage phi 11 orf12 protein homolog locus|SAOUHSC_02072, protein_id|YP_500565.1, gi|88195756, geneID|3919759
1881 1959983 1959447 537 - 0         Phage phi 11 orf61 protein homolog locus|SAOUHSC_02073, protein_id|YP_500566.1, gi|88195757, geneID|3919760
1882 1960256 1959996 261 - 12         Phage phi 11 orf11 protein homolog locus|SAOUHSC_02074, protein_id|YP_500567.1, gi|88195758, geneID|3919761
1883 1960566 1960237 330 - -20         Phage protein locus|SAOUHSC_02075, protein_id|YP_500568.1, gi|88195759, geneID|3919762
1884 1960817 1960656 162 - 89         Phage phi 11 orf10a protein homolog locus|SAOUHSC_02076, protein_id|YP_500569.1, gi|88195760, geneID|3919763
1885 1961031 1960810 222 - -8         Phage phi 11 orf10 protein homolog locus|SAOUHSC_02077, protein_id|YP_500570.1, gi|88195761, geneID|3919764
1886 1961494 1961045 450 - 13         Phage phi 11 orf9 protein homolog locus|SAOUHSC_02078, protein_id|YP_500571.1, gi|88195762, geneID|3919765
1887 1961760 1961536 225 - 41         Phage phi 11 orf8 protein homolog locus|SAOUHSC_02079, protein_id|YP_500572.1, gi|88195763, geneID|3919766
1888 1962552 1961761 792 - 0       Phage antirepressor protein locus|SAOUHSC_02080, protein_id|YP_500573.1, gi|88195764, geneID|3919767
1889 1963017 1962709 309 - 156         Phage protein locus|SAOUHSC_02081, protein_id|YP_500574.1, gi|88195765, geneID|3919768
1890 1963250 1963032 219 - 14         Phage transcriptional regulator cro locus|SAOUHSC_02083, protein_id|YP_500575.1, gi|88195766, geneID|3919769
1891 1963392 1964111 720 + 141         Phage repressor protein cI locus|SAOUHSC_02084, protein_id|YP_500576.1, gi|88195767, geneID|3919770
1892 1964181 1964348 168 + 69         Phage protein locus|SAOUHSC_02085, protein_id|YP_500577.1, gi|88195768, geneID|3919771
1893 1964508 1964693 186 + 159         Phage phi 11 orf4 protein homolog locus|SAOUHSC_02086, protein_id|YP_500578.1, gi|88195769, geneID|3919772
1894 1964729 1965634 906 + 35         Phage phi 11 orf3 protein homolog locus|SAOUHSC_02087, protein_id|YP_500579.1, gi|88195770, geneID|3919773
1895 1965883 1966929 1047 + 248 4     Phage integrase locus|SAOUHSC_02089, protein_id|YP_500581.1, gi|88195772, geneID|3919775
1896 1966974 1968119 1146 + 44     1: 1   Hypothetical protein SAV1877 locus|SAOUHSC_02090, protein_id|YP_500582.1, gi|88195773, geneID|3919776

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93061.5.peg.1888 Phage antirepressor protein
MQALQTFNFKELPVRTVEIENEPYFVGKDIAEILGYARSDNAIRNHVDSEDKLTHQFSAS
GQNRNMIIINESGLYSLIFDASKQSKNEKIRETARKFKRWVTSDVLPAIRKHGIYATDNV
IEQTLKDPDYIITVLTEYKKEKEQNLLLQQEIGELKPKADYVDEILKSTGTLATTQIAAD
YGISAQKLNKLLHEARLQRKVNKQWVLYSEHMGKSYTDSDTITIVRSDGREDTVLQTRWT
QKGRLKIHEIMTEFGYEANLGGA

MD5 = 4ce6e429fca1bdba6bc9ec8974132828


  DNA Sequence

>fig|93061.5.peg.1888 Phage antirepressor protein
atgcaagcattacaaacatttaattttaaagagctaccagtaagaacagtagaaattgaa
aacgaaccttattttgtaggaaaagatattgctgagattttaggatatgcaagatcagac
aatgccattagaaatcatgttgatagcgaggacaaactgacgcaccaatttagtgcatca
ggtcaaaacagaaatatgatcattatcaacgaatcaggattatacagtctaatcttcgat
gcttctaaacaaagcaaaaacgaaaaaattagagaaaccgctagaaaattcaaacgctgg
gtaacatcagatgtcctaccagctattcgcaaacacggtatatacgcaacagacaatgta
attgaacaaacattaaaagatccagactacatcattacagtgttgactgagtataagaaa
gaaaaagagcaaaacttacttttacaacaagaaattggagagctaaaacccaaagcagat
tatgttgatgaaatcttaaaatcaactggcacattagccacaactcaaatcgcggcagac
tacggtatatcagcacaaaagttaaacaaactactacacgaagctagactacaacgaaaa
gtaaataaacagtgggtgctttactcagaacacatgggcaagagttacacagattcagac
actataacaattgtgcgttctgatggcagagaagacacagttttacaaactagatggaca
caaaaaggcagattgaaaatacatgaaatcatgactgaattcggttatgaagctaattta
gggggagcgtaa


  DNA with Flanking Sequence

>fig|93061.5.peg.1888 Phage antirepressor protein
aaacgcaaacaaacatcttaaaggagacataacaaatgcaagaccaatcattaaaattag
taaaactacaactaaaatatcataacctttcaggacaaattgaagcttatgataaatcac
ttaaagaaataagatacactcgagatcttttcaacaaacatctaagcatgaataacgaag
acgcatttgctggtttggaaatggtagaagatgaaattactaaaaagctacgaagtgcta
tcaaagagttccaaaaagtagtgaaagcgttagacaagcttaacggtgttgaaagcgata
acaaagttactgatttaacagagtggcggaaagtgaatcagtaacattcacttcttaata
taaccacgcttatcaacatccacattgagcagatgtgagcgagagctggcgatgatatga
gccgcgtttaaatacattcgatagtcattgcgataaccgtctgctgaatgtgggtgttga
ggaaaaaggaggatactcaaatgcaagcattacaaacatttaattttaaagagctaccag
taagaacagtagaaattgaaaacgaaccttattttgtaggaaaagatattgctgagattt
taggatatgcaagatcagacaatgccattagaaatcatgttgatagcgaggacaaactga
cgcaccaatttagtgcatcaggtcaaaacagaaatatgatcattatcaacgaatcaggat
tatacagtctaatcttcgatgcttctaaacaaagcaaaaacgaaaaaattagagaaaccg
ctagaaaattcaaacgctgggtaacatcagatgtcctaccagctattcgcaaacacggta
tatacgcaacagacaatgtaattgaacaaacattaaaagatccagactacatcattacag
tgttgactgagtataagaaagaaaaagagcaaaacttacttttacaacaagaaattggag
agctaaaacccaaagcagattatgttgatgaaatcttaaaatcaactggcacattagcca
caactcaaatcgcggcagactacggtatatcagcacaaaagttaaacaaactactacacg
aagctagactacaacgaaaagtaaataaacagtgggtgctttactcagaacacatgggca
agagttacacagattcagacactataacaattgtgcgttctgatggcagagaagacacag
ttttacaaactagatggacacaaaaaggcagattgaaaatacatgaaatcatgactgaat
tcggttatgaagctaatttagggggagcgtaaatgacaccagaacaaaaagaaaagctaa
acaatatagtattaacactttatgcagttaaagaaaacaaaagtcaaacatacacacaca
aagatactcttactgtgacatatgcaggcgagattgagcacacttacgaagtcgacagag
agaaacaccttgaatcaatgattgagtgggcaattgaccaaatcgaacagcactttgatt
tagacgaagaagaataacacacacaattgaacaaacaacttaataggaggaattacaaat
gaacgcactatacaaaacaaccctcctcaccacaatggcagttgtgacgtggaaggtttg
gaagattgaacgaaatacgagaaagcctgtaatcaatagaaatgattttagtaaagagtc
tacagcagaaacgattgagcgacacagtgatcctgattcaggaataaaactacttaaggc
attttccgacttcactaaacaagctgaaaagcaaaaacctacactaggagaa


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003677       F:DNA binding
cmr|NT05SA1883 Staphylococcus aureus NCTC 8325     anti-repressor
fig|320837.3.peg.45 Bacteriophage 42e FIG   Phage antirepressor protein
fig|93061.3.peg.1965 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Phage antirepressor protein
gb|AAX91125.1 Bacteriophage 42e     ORF013
gb|ABD31132.1 Staphylococcus aureus subsp. aureus NCTC 8325     bacteriophage L54a, antirepressor, putative
gi|62636014 Bacteriophage 42e NCBI   ORF013
gi|66395521 Staphylococcus phage 42E NCBI   ORF013
gi|87203322 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   bacteriophage L54a, antirepressor, putative
gi|88195764 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   bacteriophage L54a, antirepressor, putative
img|637894707 Staphylococcus aureus aureus NCTC 8325 IMG   bacteriophage L54a, antirepressor, putative
img|638314316 Bacteriophage 42e IMG   ORF013
kegg|sao:SAOUHSC_02080 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   bacteriophage L54a, antirepressor, putative
ref|YP_239897.1 Staphylococcus phage 42E RefSeq   ORF013
ref|YP_500573.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   bacteriophage L54a, antirepressor, putative
tr|Q2FX25 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Bacteriophage L54a, antirepressor, putative
tr|Q4ZCX9 Staphylococcus phage 42E TrEMBL   ORF013


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
4 fig|93061.5.peg.1895 Phage integrase


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search