The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93061.5.peg.1887: Staphylococcus aureus subsp. aureus NCTC 8325

This feature in The SEED Viewer

NCBI Taxonomy Id: 93061

Current Assignment: Phage phi 11 orf8 protein homolog
Translate Function Assignments



Context on contig NC_007795 from base 1956244 to 1966929 (10686 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1876 1956600 1956244 357 -           Hypothetical protein, SAB1742c homolog [SA bacteriophages 11, Mu50B] locus|SAOUHSC_02068, protein_id|YP_500561.1, gi|88195752, geneID|3919755
1877 1957406 1956600 807 - -1         Phage replication initiation protein locus|SAOUHSC_02069, protein_id|YP_500562.1, gi|88195753, geneID|3919756
1878 1958070 1957378 693 - -29         Phage phi 11 orf14 protein homolog locus|SAOUHSC_02070, protein_id|YP_500563.1, gi|88195754, geneID|3919757
1879 1958637 1958083 555 - 12         Phage ssDNA binding protein locus|SAOUHSC_02071, protein_id|YP_500564.1, gi|88195755, geneID|3919758
1880 1959446 1958667 780 - 29         Phage phi 11 orf12 protein homolog locus|SAOUHSC_02072, protein_id|YP_500565.1, gi|88195756, geneID|3919759
1881 1959983 1959447 537 - 0         Phage phi 11 orf61 protein homolog locus|SAOUHSC_02073, protein_id|YP_500566.1, gi|88195757, geneID|3919760
1882 1960256 1959996 261 - 12         Phage phi 11 orf11 protein homolog locus|SAOUHSC_02074, protein_id|YP_500567.1, gi|88195758, geneID|3919761
1883 1960566 1960237 330 - -20         Phage protein locus|SAOUHSC_02075, protein_id|YP_500568.1, gi|88195759, geneID|3919762
1884 1960817 1960656 162 - 89         Phage phi 11 orf10a protein homolog locus|SAOUHSC_02076, protein_id|YP_500569.1, gi|88195760, geneID|3919763
1885 1961031 1960810 222 - -8         Phage phi 11 orf10 protein homolog locus|SAOUHSC_02077, protein_id|YP_500570.1, gi|88195761, geneID|3919764
1886 1961494 1961045 450 - 13         Phage phi 11 orf9 protein homolog locus|SAOUHSC_02078, protein_id|YP_500571.1, gi|88195762, geneID|3919765
1887 1961760 1961536 225 - 41         Phage phi 11 orf8 protein homolog locus|SAOUHSC_02079, protein_id|YP_500572.1, gi|88195763, geneID|3919766
1888 1962552 1961761 792 - 0         Phage antirepressor protein locus|SAOUHSC_02080, protein_id|YP_500573.1, gi|88195764, geneID|3919767
1889 1963017 1962709 309 - 156         Phage protein locus|SAOUHSC_02081, protein_id|YP_500574.1, gi|88195765, geneID|3919768
1890 1963250 1963032 219 - 14         Phage transcriptional regulator cro locus|SAOUHSC_02083, protein_id|YP_500575.1, gi|88195766, geneID|3919769
1891 1963392 1964111 720 + 141         Phage repressor protein cI locus|SAOUHSC_02084, protein_id|YP_500576.1, gi|88195767, geneID|3919770
1892 1964181 1964348 168 + 69         Phage protein locus|SAOUHSC_02085, protein_id|YP_500577.1, gi|88195768, geneID|3919771
1893 1964508 1964693 186 + 159         Phage phi 11 orf4 protein homolog locus|SAOUHSC_02086, protein_id|YP_500578.1, gi|88195769, geneID|3919772
1894 1964729 1965634 906 + 35         Phage phi 11 orf3 protein homolog locus|SAOUHSC_02087, protein_id|YP_500579.1, gi|88195770, geneID|3919773
1895 1965883 1966929 1047 + 248         Phage integrase locus|SAOUHSC_02089, protein_id|YP_500581.1, gi|88195772, geneID|3919775

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93061.5.peg.1887 Phage phi 11 orf8 protein homolog
MTPEQKEKLNNIVLTLYAVKENKSQTYTHKDTLTVTYAGEIEHTYEVDREKHLESMIEWA
IDQIEQHFDLDEEE

MD5 = c5249834ee817727710c490a686aa357


  DNA Sequence

>fig|93061.5.peg.1887 Phage phi 11 orf8 protein homolog
atgacaccagaacaaaaagaaaagctaaacaatatagtattaacactttatgcagttaaa
gaaaacaaaagtcaaacatacacacacaaagatactcttactgtgacatatgcaggcgag
attgagcacacttacgaagtcgacagagagaaacaccttgaatcaatgattgagtgggca
attgaccaaatcgaacagcactttgatttagacgaagaagaataa


  DNA with Flanking Sequence

>fig|93061.5.peg.1887 Phage phi 11 orf8 protein homolog
aacgctgggtaacatcagatgtcctaccagctattcgcaaacacggtatatacgcaacag
acaatgtaattgaacaaacattaaaagatccagactacatcattacagtgttgactgagt
ataagaaagaaaaagagcaaaacttacttttacaacaagaaattggagagctaaaaccca
aagcagattatgttgatgaaatcttaaaatcaactggcacattagccacaactcaaatcg
cggcagactacggtatatcagcacaaaagttaaacaaactactacacgaagctagactac
aacgaaaagtaaataaacagtgggtgctttactcagaacacatgggcaagagttacacag
attcagacactataacaattgtgcgttctgatggcagagaagacacagttttacaaacta
gatggacacaaaaaggcagattgaaaatacatgaaatcatgactgaattcggttatgaag
ctaatttagggggagcgtaaatgacaccagaacaaaaagaaaagctaaacaatatagtat
taacactttatgcagttaaagaaaacaaaagtcaaacatacacacacaaagatactctta
ctgtgacatatgcaggcgagattgagcacacttacgaagtcgacagagagaaacaccttg
aatcaatgattgagtgggcaattgaccaaatcgaacagcactttgatttagacgaagaag
aataacacacacaattgaacaaacaacttaataggaggaattacaaatgaacgcactata
caaaacaaccctcctcaccacaatggcagttgtgacgtggaaggtttggaagattgaacg
aaatacgagaaagcctgtaatcaatagaaatgattttagtaaagagtctacagcagaaac
gattgagcgacacagtgatcctgattcaggaataaaactacttaaggcattttccgactt
cactaaacaagctgaaaagcaaaaacctacactaggagaagtttatagacggaacaaacc
tgaattaccaaccgttactttagacgaaaacggactgtttataaatgattttagggtgcc
ttatgtacttgaggaaggggttaacgtaaagaaatctatgaacaacctatataaggtcag
tttggactttttcgctaaaagtattattgcagataattacgaagcagataacccagagaa
tcaacagttattttaaaggaggaaa


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT02SA0852 Staphylococcus aureus Mu50     conserved hypothetical protein
cmr|NT05SA1882 Staphylococcus aureus NCTC 8325     conserved hypothetical protein
cmr|SACOL0326 Staphylococcus aureus subsp. aureus COL     hypothetical protein
dbj|BAB57018.1 Staphylococcus aureus subsp. aureus Mu50     hypothetical protein
dbj|BAF43824.1 Staphylococcus phage phiETA2     hypothetical protein
dbj|BAF43893.1 Staphylococcus phage phiETA3     hypothetical protein
dbj|BAF77734.1 Staphylococcus aureus subsp. aureus Mu3     hypothetical protein
dbj|BAG48105.1 Staphylococcus phage phiMR25     hypothetical protein
fig|12360.1.peg.8 Staphylococcus aureus phage phi 11 FIG   Phage phi 11 orf8 protein homolog
fig|158878.1.peg.856 Staphylococcus aureus subsp. aureus Mu50 FIG   Phage phi 11 orf8 protein homolog
fig|158878.14.peg.881 Staphylococcus aureus subsp. aureus Mu50 FIG   Phage phi 11 orf8 protein homolog
fig|320833.3.peg.39 Bacteriophage 187 FIG   Phage phi 11 orf8 protein homolog
fig|320837.3.peg.46 Bacteriophage 42e FIG   Phage phi 11 orf8 protein homolog
fig|326036.2.peg.9 Siphoviridae Staphylococcus phage phiETA2 FIG   Phage phi 11 orf8 protein homolog
fig|326037.2.peg.9 Siphoviridae Staphylococcus phage phiETA3 FIG   Phage phi 11 orf8 protein homolog
fig|359786.13.peg.925 Staphylococcus aureus subsp. aureus JH9 FIG   Phage phi 11 orf8 protein homolog
fig|359786.3.peg.2110 Staphylococcus aureus subsp. aureus JH9 FIG   Phage phi 11 orf8 protein homolog
fig|359787.11.peg.913 Staphylococcus aureus subsp. aureus JH1 FIG   Phage phi 11 orf8 protein homolog
fig|359787.3.peg.2305 Staphylococcus aureus subsp. aureus JH1 FIG   Phage phi 11 orf8 protein homolog
fig|418127.4.peg.795 Staphylococcus aureus subsp. aureus Mu3 FIG   Phage phi 11 orf8 protein homolog
fig|418127.6.peg.871 Staphylococcus aureus subsp. aureus Mu3 FIG   Phage phi 11 orf8 protein homolog
fig|487152.2.peg.8 Siphoviridae Staphylococcus phage phiMR25 FIG   Phage phi 11 orf8 protein homolog
fig|505321.3.peg.2437 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   Phage phi 11 orf8 protein homolog
fig|553565.3.peg.644 Staphylococcus aureus A5937 FIG   Phage phi 11 orf8 protein homolog
fig|553568.3.peg.1261 Staphylococcus aureus A6224 FIG   Phage phi 11 orf8 protein homolog
fig|553577.3.peg.1359 Staphylococcus aureus A8796 FIG   Phage phi 11 orf8 protein homolog
fig|553580.3.peg.1701 Staphylococcus aureus A8819 FIG   Phage phi 11 orf8 protein homolog
fig|553588.3.peg.1779 Staphylococcus aureus A9719 FIG   Phage phi 11 orf8 protein homolog
fig|553592.3.peg.2488 Staphylococcus aureus A9763 FIG   Phage phi 11 orf8 protein homolog
fig|553596.3.peg.1755 Staphylococcus aureus A9781 FIG   Phage phi 11 orf8 protein homolog
fig|553601.3.peg.2636 Staphylococcus aureus A10102 FIG   Phage phi 11 orf8 protein homolog
fig|55511.2.peg.40 Siphoviridae Staphylococcus phage 187 FIG   Phage phi 11 orf8 protein homolog
fig|585151.3.peg.1556 Staphylococcus aureus subsp. aureus C427 FIG   Phage phi 11 orf8 protein homolog
fig|585891.3.peg.880 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Phage phi 11 orf8 protein homolog
fig|703339.3.peg.826 Staphylococcus aureus 04-02981 FIG   Phage phi 11 orf8 protein homolog
fig|93061.3.peg.1964 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Phage phi 11 orf8 protein homolog
fig|93062.19.peg.317 Staphylococcus aureus subsp. aureus COL FIG   Phage phi 11 orf8 protein homolog
fig|93062.4.peg.785 Staphylococcus aureus subsp. aureus COL FIG   Phage phi 11 orf8 protein homolog
gb|AAL82236.1 Staphylococcus aureus phage phi 11     unknown protein
gb|AAW37533.1 Staphylococcus aureus subsp. aureus COL     hypothetical protein SACOL0326
gb|AAX90733.1 Bacteriophage 187     ORF073
gb|AAX91170.1 Bacteriophage 42e     ORF071
gb|ABD31131.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical phage protein
gb|ABQ48657.1 Staphylococcus aureus subsp. aureus JH9     hypothetical protein SaurJH9_0856
gb|ABR51728.1 Staphylococcus aureus subsp. aureus JH1     conserved hypothetical protein
gb|EEV27160.1 Staphylococcus aureus A9781     conserved hypothetical protein
gb|EEV63436.1 Staphylococcus aureus A9763     conserved hypothetical protein
gb|EEV66811.1 Staphylococcus aureus A9719     phage protein
gb|EEV80728.1 Staphylococcus aureus A6224     conserved hypothetical protein
gb|EEV86539.1 Staphylococcus aureus A5937     conserved hypothetical protein
gi|121309202 Staphylococcus phage phiETA2 NCBI   hypothetical protein
gi|121309272 Staphylococcus phage phiETA3 NCBI   hypothetical protein
gi|122891723 Staphylococcus phage phiETA2 NCBI   hypothetical protein phiETA2_gp09
gi|122891793 Staphylococcus phage phiETA3 NCBI   hypothetical protein phiETA3_gp09
gi|14246625 Staphylococcus aureus subsp. aureus Mu50 NCBI   hypothetical protein
gi|147740359 Staphylococcus aureus subsp. aureus JH9 NCBI   hypothetical protein SaurJH9_0856
gi|148267290 Staphylococcus aureus subsp. aureus JH9 NCBI   hypothetical protein SaurJH9_0856
gi|149945792 Staphylococcus aureus subsp. aureus JH1 NCBI   conserved hypothetical protein
gi|150393340 Staphylococcus aureus subsp. aureus JH1 NCBI   hypothetical protein SaurJH1_0872
gi|156721317 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein
gi|156979182 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_0851
gi|15923846 Staphylococcus aureus subsp. aureus Mu50 NCBI   hypothetical protein SAV0856
gi|18920495 Staphylococcus aureus phage phi 11 NCBI   unknown protein
gi|189339041 Staphylococcus phage phiMR25 NCBI   hypothetical protein
gi|189427130 Staphylococcus phage phiMR25 NCBI   hypothetical protein
gi|253316885 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   hypothetical protein SauraC_12214
gi|255005644 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   hypothetical protein SauraM_04215
gi|257788820 Staphylococcus aureus A9781 NCBI   conserved hypothetical protein
gi|257794848 Staphylococcus aureus A9781 NCBI   conserved hypothetical protein
gi|257838957 Staphylococcus aureus A9763 NCBI   conserved hypothetical protein
gi|257842387 Staphylococcus aureus A9719 NCBI   phage protein
gi|257857836 Staphylococcus aureus A6224 NCBI   conserved hypothetical protein
gi|257863783 Staphylococcus aureus A5937 NCBI   conserved hypothetical protein
gi|258418164 Staphylococcus aureus A9763 NCBI   conserved hypothetical protein
gi|258421461 Staphylococcus aureus A9719 NCBI   phage protein
gi|258448940 Staphylococcus aureus A6224 NCBI   conserved hypothetical protein
gi|258453918 Staphylococcus aureus A5937 NCBI   conserved hypothetical protein
gi|29028571 Staphylococcus phage 11 NCBI   hypothetical protein phi11_08
gi|57285439 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL0326
gi|57651253 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL0326
gi|62635622 Bacteriophage 187 NCBI   ORF073
gi|62636059 Bacteriophage 42e NCBI   ORF071
gi|66395270 Staphylococcus phage 187 NCBI   ORF073
gi|66395566 Staphylococcus phage 42E NCBI   ORF071
gi|87203321 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical phage protein
gi|88195763 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_02079
img|637099369 Staphylococcus aureus aureus Mu50 IMG   hypothetical protein
img|637151101 Staphylococcus aureus aureus COL IMG   hypothetical protein
img|637894706 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|638297003 Staphylococcus phage 11 IMG   unknown protein
img|638313946 Bacteriophage 187 IMG   ORF073
img|638314317 Bacteriophage 42e IMG   ORF071
img|639108143 Staphylococcus aureus aureus JH1 IMG   conserved hypothetical protein
img|640565206 Staphylococcus aureus aureus JH9 IMG   hypothetical protein
img|640778959 Staphylococcus aureus aureus JH1 IMG   hypothetical protein
img|640903592 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
img|641206391 Staphylococcus phage phiETA2 IMG   hypothetical protein
img|641206460 Staphylococcus phage phiETA3 IMG   hypothetical protein
img|642919254 Staphylococcus phage phiMR25 IMG   hypothetical protein
kegg|sac:SACOL0326 Staphylococcus aureus subsp. aureus COL KEGG   hypothetical protein
kegg|sah:SaurJH1_0872 Staphylococcus aureus subsp. aureus JH1 KEGG   hypothetical protein
kegg|saj:SaurJH9_0856 Staphylococcus aureus subsp. aureus JH9 KEGG   hypothetical protein
kegg|sao:SAOUHSC_02079 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sav:SAV0856   KEGG   hypothetical protein
kegg|saw:SAHV_0851 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
ref|NP_371380.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   hypothetical protein SAV0856
ref|NP_803261.1 Staphylococcus phage 11 RefSeq   hypothetical protein phi11_08
ref|YP_001004269.1 Staphylococcus phage phiETA2 RefSeq   hypothetical protein phiETA2_gp09
ref|YP_001004338.1 Staphylococcus phage phiETA3 RefSeq   hypothetical protein phiETA3_gp09
ref|YP_001246233.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   hypothetical protein SaurJH9_0856
ref|YP_001316015.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   hypothetical protein SaurJH1_0872
ref|YP_001441441.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_0851
ref|YP_001949806.1 Staphylococcus phage phiMR25 RefSeq   hypothetical protein
ref|YP_185218.1 Staphylococcus aureus subsp. aureus COL RefSeq   hypothetical protein SACOL0326
ref|YP_239527.1 Staphylococcus phage 187 RefSeq   ORF073
ref|YP_239898.1 Staphylococcus phage 42E RefSeq   ORF071
ref|YP_500572.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_02079
ref|ZP_04840098.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   hypothetical protein SauraC_12214
ref|ZP_05144245.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   hypothetical protein SauraM_04215
ref|ZP_05643827.1 Staphylococcus aureus A9781 RefSeq   conserved hypothetical protein
ref|ZP_05682429.1 Staphylococcus aureus A9763 RefSeq   conserved hypothetical protein
ref|ZP_05684386.1 Staphylococcus aureus A9719 RefSeq   phage protein
ref|ZP_05697049.1 Staphylococcus aureus A6224 RefSeq   conserved hypothetical protein
ref|ZP_05701890.1 Staphylococcus aureus A5937 RefSeq   conserved hypothetical protein
tr|A1KWZ1 Staphylococcus phage phiETA2 TrEMBL   Putative uncharacterized protein
tr|A1KX60 Staphylococcus phage phiETA3 TrEMBL   Putative uncharacterized protein
tr|A5IR34 Staphylococcus aureus (strain JH9) TrEMBL   Putative uncharacterized protein
tr|A6TZW0 Staphylococcus aureus (strain JH1) TrEMBL   Putative uncharacterized protein
tr|A7X044 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Putative uncharacterized protein
tr|B2ZYU6 Staphylococcus phage phiMR25 TrEMBL   Putative uncharacterized protein orf8
tr|Q2FX26 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Conserved hypothetical phage protein
tr|Q4ZCX8 Staphylococcus phage 42E TrEMBL   ORF071
tr|Q4ZDZ9 Staphylococcus phage 187 TrEMBL   ORF073
tr|Q5HJ39 Staphylococcus aureus (strain COL) TrEMBL   Putative uncharacterized protein
tr|Q8SDW9 Staphylococcus phage phi11 (Bacteriophage phi-11) TrEMBL   Putative uncharacterized protein
tr|Q932B5 Staphylococcus aureus (strain Mu50 / ATCC 700699) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search