The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93061.5.peg.1885: Staphylococcus aureus subsp. aureus NCTC 8325

This feature in The SEED Viewer

NCBI Taxonomy Id: 93061

Current Assignment: Phage phi 11 orf10 protein homolog
Translate Function Assignments



Context on contig NC_007795 from base 1955006 to 1966929 (11924 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1875 1956247 1955006 1242 -           Phage DNA helicase (EC 3.6.4.12) locus|SAOUHSC_02067, protein_id|YP_500560.1, gi|88195751, geneID|3919754
1876 1956600 1956244 357 - -4         Hypothetical protein, SAB1742c homolog [SA bacteriophages 11, Mu50B] locus|SAOUHSC_02068, protein_id|YP_500561.1, gi|88195752, geneID|3919755
1877 1957406 1956600 807 - -1         Phage replication initiation protein locus|SAOUHSC_02069, protein_id|YP_500562.1, gi|88195753, geneID|3919756
1878 1958070 1957378 693 - -29         Phage phi 11 orf14 protein homolog locus|SAOUHSC_02070, protein_id|YP_500563.1, gi|88195754, geneID|3919757
1879 1958637 1958083 555 - 12         Phage ssDNA binding protein locus|SAOUHSC_02071, protein_id|YP_500564.1, gi|88195755, geneID|3919758
1880 1959446 1958667 780 - 29         Phage phi 11 orf12 protein homolog locus|SAOUHSC_02072, protein_id|YP_500565.1, gi|88195756, geneID|3919759
1881 1959983 1959447 537 - 0         Phage phi 11 orf61 protein homolog locus|SAOUHSC_02073, protein_id|YP_500566.1, gi|88195757, geneID|3919760
1882 1960256 1959996 261 - 12         Phage phi 11 orf11 protein homolog locus|SAOUHSC_02074, protein_id|YP_500567.1, gi|88195758, geneID|3919761
1883 1960566 1960237 330 - -20         Phage protein locus|SAOUHSC_02075, protein_id|YP_500568.1, gi|88195759, geneID|3919762
1884 1960817 1960656 162 - 89         Phage phi 11 orf10a protein homolog locus|SAOUHSC_02076, protein_id|YP_500569.1, gi|88195760, geneID|3919763
1885 1961031 1960810 222 - -8         Phage phi 11 orf10 protein homolog locus|SAOUHSC_02077, protein_id|YP_500570.1, gi|88195761, geneID|3919764
1886 1961494 1961045 450 - 13         Phage phi 11 orf9 protein homolog locus|SAOUHSC_02078, protein_id|YP_500571.1, gi|88195762, geneID|3919765
1887 1961760 1961536 225 - 41         Phage phi 11 orf8 protein homolog locus|SAOUHSC_02079, protein_id|YP_500572.1, gi|88195763, geneID|3919766
1888 1962552 1961761 792 - 0         Phage antirepressor protein locus|SAOUHSC_02080, protein_id|YP_500573.1, gi|88195764, geneID|3919767
1889 1963017 1962709 309 - 156         Phage protein locus|SAOUHSC_02081, protein_id|YP_500574.1, gi|88195765, geneID|3919768
1890 1963250 1963032 219 - 14         Phage transcriptional regulator cro locus|SAOUHSC_02083, protein_id|YP_500575.1, gi|88195766, geneID|3919769
1891 1963392 1964111 720 + 141         Phage repressor protein cI locus|SAOUHSC_02084, protein_id|YP_500576.1, gi|88195767, geneID|3919770
1892 1964181 1964348 168 + 69         Phage protein locus|SAOUHSC_02085, protein_id|YP_500577.1, gi|88195768, geneID|3919771
1893 1964508 1964693 186 + 159         Phage phi 11 orf4 protein homolog locus|SAOUHSC_02086, protein_id|YP_500578.1, gi|88195769, geneID|3919772
1894 1964729 1965634 906 + 35         Phage phi 11 orf3 protein homolog locus|SAOUHSC_02087, protein_id|YP_500579.1, gi|88195770, geneID|3919773
1895 1965883 1966929 1047 + 248         Phage integrase locus|SAOUHSC_02089, protein_id|YP_500581.1, gi|88195772, geneID|3919775

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93061.5.peg.1885 Phage phi 11 orf10 protein homolog
MMKNSLQAKELAVILSVSKSKAGQIIRELNKELEDEGYIAIRGRIPVQLARKKFPYHDLS
DQRIMEELKKENE

MD5 = dc060af0a0a26b6e875ece45b8aea6d1


  DNA Sequence

>fig|93061.5.peg.1885 Phage phi 11 orf10 protein homolog
atgatgaaaaatagtttgcaagctaaagaacttgcggtaattttatctgtttctaaatcc
aaagcaggacaaataataagagaactgaataaagagcttgaagatgaaggatacattgcg
atacgaggcagaataccagtccaattagctaggaaaaaattcccttatcacgacttatca
gaccagagaataatggaggagttgaaaaaagaaaatgagtaa


  DNA with Flanking Sequence

>fig|93061.5.peg.1885 Phage phi 11 orf10 protein homolog
cacaattgaacaaacaacttaataggaggaattacaaatgaacgcactatacaaaacaac
cctcctcaccacaatggcagttgtgacgtggaaggtttggaagattgaacgaaatacgag
aaagcctgtaatcaatagaaatgattttagtaaagagtctacagcagaaacgattgagcg
acacagtgatcctgattcaggaataaaactacttaaggcattttccgacttcactaaaca
agctgaaaagcaaaaacctacactaggagaagtttatagacggaacaaacctgaattacc
aaccgttactttagacgaaaacggactgtttataaatgattttagggtgccttatgtact
tgaggaaggggttaacgtaaagaaatctatgaacaacctatataaggtcagtttggactt
tttcgctaaaagtattattgcagataattacgaagcagataacccagagaatcaacagtt
attttaaaggaggaaaagatatgatgaaaaatagtttgcaagctaaagaacttgcggtaa
ttttatctgtttctaaatccaaagcaggacaaataataagagaactgaataaagagcttg
aagatgaaggatacattgcgatacgaggcagaataccagtccaattagctaggaaaaaat
tcccttatcacgacttatcagaccagagaataatggaggagttgaaaaaagaaaatgagt
aacatttataaaagctacctagtagcagtactatgcttcacagtcttagcgattgtactt
atgccgtttctatacttcactacagcatggtcaattgcaggattcgcaagtatcgcaaca
ttcatattctataaggaatacttttatgaagaatgaaaaaactgctacttgcgccaacaa
gtaacaataagtgttcatcaaaatatacaacttaattaaatcaaaatatacggaggtagt
caactatgactgaaaatattaaaactgaacaacattattacactaaagatttttcaggat
acagaaatgaagaagataactttgtagcaaatcaagaattgacagtaacaatcacattga
acgagtacagaaaacttattgaaataaaggctgttaaagataaagaagaagatacttaca
gaggtaagtattttgcggaagaaagaaaaaacgaaaaattggaaaaagaaaatataaaac
taaaaaacaaaatttatgaatt


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT05SA1880 Staphylococcus aureus NCTC 8325     conserved hypothetical protein
dbj|BAF43895.1 Staphylococcus phage phiETA3     hypothetical protein
fig|12360.1.peg.10 Staphylococcus aureus phage phi 11 FIG   Phage phi 11 orf10 protein homolog
fig|320837.3.peg.48 Bacteriophage 42e FIG   Phage phi 11 orf10 protein homolog
fig|326037.2.peg.11 Siphoviridae Staphylococcus phage phiETA3 FIG   Phage phi 11 orf10 protein homolog
fig|359786.13.peg.927 Staphylococcus aureus subsp. aureus JH9 FIG   Phage phi 11 orf10 protein homolog
fig|359786.3.peg.2108 Staphylococcus aureus subsp. aureus JH9 FIG   Phage phi 11 orf10 protein homolog
fig|359787.3.peg.2307 Staphylococcus aureus subsp. aureus JH1 FIG   Phage phi 11 orf10 protein homolog
fig|505321.3.peg.2438 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   Phage phi 11 orf10 protein homolog
fig|553565.3.peg.642 Staphylococcus aureus A5937 FIG   Phage phi 11 orf10 protein homolog
fig|553577.3.peg.1361 Staphylococcus aureus A8796 FIG   Phage phi 11 orf10 protein homolog
fig|553580.3.peg.1703 Staphylococcus aureus A8819 FIG   Phage phi 11 orf10 protein homolog
fig|553588.3.peg.1777 Staphylococcus aureus A9719 FIG   Phage phi 11 orf10 protein homolog
fig|553592.3.peg.2486 Staphylococcus aureus A9763 FIG   Phage phi 11 orf10 protein homolog
fig|553601.3.peg.2638 Staphylococcus aureus A10102 FIG   Phage phi 11 orf10 protein homolog
fig|703339.3.peg.828 Staphylococcus aureus 04-02981 FIG   Phage phi 11 orf10 protein homolog
gb|AAL82238.1 Staphylococcus aureus phage phi 11     phi PV83 orf 12-like protein
gb|AAX91171.1 Bacteriophage 42e     ORF072
gb|ABQ48659.1 Staphylococcus aureus subsp. aureus JH9     hypothetical protein SaurJH9_0858
gb|ABR51730.1 Staphylococcus aureus subsp. aureus JH1     phi PV83 orf 12-like protein-related protein
gb|EEV27158.1 Staphylococcus aureus A9781     conserved hypothetical protein
gb|EEV63434.1 Staphylococcus aureus A9763     conserved hypothetical protein
gb|EEV66809.1 Staphylococcus aureus A9719     phage protein
gb|EEV86537.1 Staphylococcus aureus A5937     conserved hypothetical protein
gi|121309274 Staphylococcus phage phiETA3 NCBI   hypothetical protein
gi|122891795 Staphylococcus phage phiETA3 NCBI   hypothetical protein phiETA3_gp11
gi|147740361 Staphylococcus aureus subsp. aureus JH9 NCBI   hypothetical protein SaurJH9_0858
gi|148267292 Staphylococcus aureus subsp. aureus JH9 NCBI   hypothetical protein SaurJH9_0858
gi|149945794 Staphylococcus aureus subsp. aureus JH1 NCBI   phi PV83 orf 12-like protein-related protein
gi|150393342 Staphylococcus aureus subsp. aureus JH1 NCBI   phi PV83 orf 12-like protein-related protein
gi|18920497 Staphylococcus aureus phage phi 11 NCBI   phi PV83 orf 12-like protein
gi|257788818 Staphylococcus aureus A9781 NCBI   conserved hypothetical protein
gi|257794846 Staphylococcus aureus A9781 NCBI   conserved hypothetical protein
gi|257838955 Staphylococcus aureus A9763 NCBI   conserved hypothetical protein
gi|257842385 Staphylococcus aureus A9719 NCBI   phage protein
gi|257863781 Staphylococcus aureus A5937 NCBI   conserved hypothetical protein
gi|258418162 Staphylococcus aureus A9763 NCBI   conserved hypothetical protein
gi|258421459 Staphylococcus aureus A9719 NCBI   phage protein
gi|258453916 Staphylococcus aureus A5937 NCBI   conserved hypothetical protein
gi|29028573 Staphylococcus phage 11 NCBI   phi PV83 orf 12-like protein
gi|62636060 Bacteriophage 42e NCBI   ORF072
gi|66395567 Staphylococcus phage 42E NCBI   ORF072
img|638297005 Staphylococcus phage 11 IMG   phi PV83 orf 12-like protein
img|638314319 Bacteriophage 42e IMG   ORF072
img|639108145 Staphylococcus aureus aureus JH1 IMG   conserved hypothetical protein
img|640565208 Staphylococcus aureus aureus JH9 IMG   hypothetical protein
img|640778961 Staphylococcus aureus aureus JH1 IMG   phi PV83 orf 12-like protein-related protein
img|641206462 Staphylococcus phage phiETA3 IMG   hypothetical protein
kegg|sah:SaurJH1_0874 Staphylococcus aureus subsp. aureus JH1 KEGG   phi PV83 orf 12-like protein-related protein
kegg|saj:SaurJH9_0858 Staphylococcus aureus subsp. aureus JH9 KEGG   hypothetical protein
ref|NP_803263.1 Staphylococcus phage 11 RefSeq   phi PV83 orf 12-like protein
ref|YP_001004340.1 Staphylococcus phage phiETA3 RefSeq   hypothetical protein phiETA3_gp11
ref|YP_001246235.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   hypothetical protein SaurJH9_0858
ref|YP_001316017.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   phi PV83 orf 12-like protein-related protein
ref|YP_239900.1 Staphylococcus phage 42E RefSeq   ORF072
ref|ZP_05643825.1 Staphylococcus aureus A9781 RefSeq   conserved hypothetical protein
ref|ZP_05682427.1 Staphylococcus aureus A9763 RefSeq   conserved hypothetical protein
ref|ZP_05684384.1 Staphylococcus aureus A9719 RefSeq   phage protein
ref|ZP_05701888.1 Staphylococcus aureus A5937 RefSeq   conserved hypothetical protein
tr|A1KX62 Staphylococcus phage phiETA3 TrEMBL   Putative uncharacterized protein
tr|A5IR36 Staphylococcus aureus (strain JH9) TrEMBL   Putative uncharacterized protein precursor
tr|A6TZW2 Staphylococcus aureus (strain JH1) TrEMBL   Phi PV83 orf 12-like protein-related protein precursor
tr|Q4ZCX6 Staphylococcus phage 42E TrEMBL   ORF072
tr|Q8SDW7 Staphylococcus phage phi11 (Bacteriophage phi-11) TrEMBL   Phi PV83 orf 12-like protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search