The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93061.5.peg.1884: Staphylococcus aureus subsp. aureus NCTC 8325

This feature in The SEED Viewer

NCBI Taxonomy Id: 93061

Current Assignment: Phage phi 11 orf10a protein homolog
Translate Function Assignments



Context on contig NC_007795 from base 1955006 to 1965634 (10629 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1875 1956247 1955006 1242 -           Phage DNA helicase (EC 3.6.4.12) locus|SAOUHSC_02067, protein_id|YP_500560.1, gi|88195751, geneID|3919754
1876 1956600 1956244 357 - -4         Hypothetical protein, SAB1742c homolog [SA bacteriophages 11, Mu50B] locus|SAOUHSC_02068, protein_id|YP_500561.1, gi|88195752, geneID|3919755
1877 1957406 1956600 807 - -1         Phage replication initiation protein locus|SAOUHSC_02069, protein_id|YP_500562.1, gi|88195753, geneID|3919756
1878 1958070 1957378 693 - -29         Phage phi 11 orf14 protein homolog locus|SAOUHSC_02070, protein_id|YP_500563.1, gi|88195754, geneID|3919757
1879 1958637 1958083 555 - 12         Phage ssDNA binding protein locus|SAOUHSC_02071, protein_id|YP_500564.1, gi|88195755, geneID|3919758
1880 1959446 1958667 780 - 29         Phage phi 11 orf12 protein homolog locus|SAOUHSC_02072, protein_id|YP_500565.1, gi|88195756, geneID|3919759
1881 1959983 1959447 537 - 0         Phage phi 11 orf61 protein homolog locus|SAOUHSC_02073, protein_id|YP_500566.1, gi|88195757, geneID|3919760
1882 1960256 1959996 261 - 12         Phage phi 11 orf11 protein homolog locus|SAOUHSC_02074, protein_id|YP_500567.1, gi|88195758, geneID|3919761
1883 1960566 1960237 330 - -20         Phage protein locus|SAOUHSC_02075, protein_id|YP_500568.1, gi|88195759, geneID|3919762
1884 1960817 1960656 162 - 89         Phage phi 11 orf10a protein homolog locus|SAOUHSC_02076, protein_id|YP_500569.1, gi|88195760, geneID|3919763
1885 1961031 1960810 222 - -8         Phage phi 11 orf10 protein homolog locus|SAOUHSC_02077, protein_id|YP_500570.1, gi|88195761, geneID|3919764
1886 1961494 1961045 450 - 13         Phage phi 11 orf9 protein homolog locus|SAOUHSC_02078, protein_id|YP_500571.1, gi|88195762, geneID|3919765
1887 1961760 1961536 225 - 41         Phage phi 11 orf8 protein homolog locus|SAOUHSC_02079, protein_id|YP_500572.1, gi|88195763, geneID|3919766
1888 1962552 1961761 792 - 0         Phage antirepressor protein locus|SAOUHSC_02080, protein_id|YP_500573.1, gi|88195764, geneID|3919767
1889 1963017 1962709 309 - 156         Phage protein locus|SAOUHSC_02081, protein_id|YP_500574.1, gi|88195765, geneID|3919768
1890 1963250 1963032 219 - 14         Phage transcriptional regulator cro locus|SAOUHSC_02083, protein_id|YP_500575.1, gi|88195766, geneID|3919769
1891 1963392 1964111 720 + 141         Phage repressor protein cI locus|SAOUHSC_02084, protein_id|YP_500576.1, gi|88195767, geneID|3919770
1892 1964181 1964348 168 + 69         Phage protein locus|SAOUHSC_02085, protein_id|YP_500577.1, gi|88195768, geneID|3919771
1893 1964508 1964693 186 + 159         Phage phi 11 orf4 protein homolog locus|SAOUHSC_02086, protein_id|YP_500578.1, gi|88195769, geneID|3919772
1894 1964729 1965634 906 + 35         Phage phi 11 orf3 protein homolog locus|SAOUHSC_02087, protein_id|YP_500579.1, gi|88195770, geneID|3919773

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93061.5.peg.1884 Phage phi 11 orf10a protein homolog
MSNIYKSYLVAVLCFTVLAIVLMPFLYFTTAWSIAGFASIATFIFYKEYFYEE

MD5 = 1df02de83b8584ef6677c3cf60b0ff90


  DNA Sequence

>fig|93061.5.peg.1884 Phage phi 11 orf10a protein homolog
atgagtaacatttataaaagctacctagtagcagtactatgcttcacagtcttagcgatt
gtacttatgccgtttctatacttcactacagcatggtcaattgcaggattcgcaagtatc
gcaacattcatattctataaggaatacttttatgaagaatga


  DNA with Flanking Sequence

>fig|93061.5.peg.1884 Phage phi 11 orf10a protein homolog
aaggcattttccgacttcactaaacaagctgaaaagcaaaaacctacactaggagaagtt
tatagacggaacaaacctgaattaccaaccgttactttagacgaaaacggactgtttata
aatgattttagggtgccttatgtacttgaggaaggggttaacgtaaagaaatctatgaac
aacctatataaggtcagtttggactttttcgctaaaagtattattgcagataattacgaa
gcagataacccagagaatcaacagttattttaaaggaggaaaagatatgatgaaaaatag
tttgcaagctaaagaacttgcggtaattttatctgtttctaaatccaaagcaggacaaat
aataagagaactgaataaagagcttgaagatgaaggatacattgcgatacgaggcagaat
accagtccaattagctaggaaaaaattcccttatcacgacttatcagaccagagaataat
ggaggagttgaaaaaagaaaatgagtaacatttataaaagctacctagtagcagtactat
gcttcacagtcttagcgattgtacttatgccgtttctatacttcactacagcatggtcaa
ttgcaggattcgcaagtatcgcaacattcatattctataaggaatacttttatgaagaat
gaaaaaactgctacttgcgccaacaagtaacaataagtgttcatcaaaatatacaactta
attaaatcaaaatatacggaggtagtcaactatgactgaaaatattaaaactgaacaaca
ttattacactaaagatttttcaggatacagaaatgaagaagataactttgtagcaaatca
agaattgacagtaacaatcacattgaacgagtacagaaaacttattgaaataaaggctgt
taaagataaagaagaagatacttacagaggtaagtattttgcggaagaaagaaaaaacga
aaaattggaaaaagaaaatataaaactaaaaaacaaaatttatgaattacaaaacgaaga
agataacgaggaggacgaagaagacaaggaggacgagaacgatgtattacaaaattggtg
agataaaaaacaaaattataagctttaacgggtttgaatttaaagtgtctgtgatgaaga
gacatgacggtatcagtataca


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT03SA2086 Staphylococcus aureus MW2     conserved hypothetical protein
cmr|NT05SA1879 Staphylococcus aureus NCTC 8325     conserved domain protein
cmr|NT09SA1920 Staphylococcus aureus subsp. aureus MSSA476     putative exported protein
dbj|BAB95792.1 Staphylococcus aureus subsp. aureus MW2     hypothetical protein
emb|CAG43717.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   putative exported protein
fig|186153.1.peg.9 Staphylococcus aureus phage phi 13 FIG   Phage phi 11 orf10a protein homolog
fig|196620.1.peg.1927 Staphylococcus aureus subsp. aureus MW2 FIG   Phage phi 11 orf10a protein homolog
fig|196620.5.peg.2003 Staphylococcus aureus subsp. aureus MW2 FIG   Phage phi 11 orf10a protein homolog
fig|282459.1.peg.1890 Staphylococcus aureus subsp. aureus MSSA476 FIG   Phage phi 11 orf10a protein homolog
fig|282459.5.peg.1988 Staphylococcus aureus subsp. aureus MSSA476 FIG   Phage phi 11 orf10a protein homolog
fig|320837.3.peg.49 Bacteriophage 42e FIG   Phage phi 11 orf10a protein homolog
fig|359786.13.peg.360 Staphylococcus aureus subsp. aureus JH9 FIG   Phage phi 11 orf10a protein homolog
fig|359786.3.peg.1174 Staphylococcus aureus subsp. aureus JH9 FIG   Phage phi 11 orf10a protein homolog
fig|359787.11.peg.357 Staphylococcus aureus subsp. aureus JH1 FIG   Phage phi 11 orf10a protein homolog
fig|359787.3.peg.2049 Staphylococcus aureus subsp. aureus JH1 FIG   Phage phi 11 orf10a protein homolog
fig|445515.2.peg.11 Viruses Staphylococcus phage tp310-1 Viruses. FIG   Phage phi 11 orf10a protein homolog
fig|452948.4.peg.2747 Staphylococcus aureus 930918-3 FIG   Phage phi 11 orf10a protein homolog
fig|546343.3.peg.1574 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Phage phi 11 orf10a protein homolog
fig|548475.3.peg.2417 Staphylococcus aureus subsp. aureus TCH70 FIG   Phage phi 11 orf10a protein homolog
fig|553573.3.peg.2309 Staphylococcus aureus A8115 FIG   Phage phi 11 orf10a protein homolog
fig|553594.3.peg.2738 Staphylococcus aureus A9765 FIG   Phage phi 11 orf10a protein homolog
fig|585151.3.peg.1691 Staphylococcus aureus subsp. aureus C427 FIG   Phage phi 11 orf10a protein homolog
fig|585152.3.peg.1965 Staphylococcus aureus subsp. aureus D139 FIG   Phage phi 11 orf10a protein homolog
fig|585155.3.peg.2603 Staphylococcus aureus subsp. aureus H19 FIG   Phage phi 11 orf10a protein homolog
fig|644279.4.peg.2144 Staphylococcus aureus subsp. aureus 132 FIG   Phage phi 11 orf10a protein homolog
fig|93061.3.peg.1961 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Phage phi 11 orf10a protein homolog
fig|93061.3.peg.2101 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Phage phi 11 orf10a protein homolog
fig|93061.5.peg.2019 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Phage phi 11 orf10a protein homolog
gb|AAL82339.1 Staphylococcus aureus phage phi 13     phi PVL orf 38-like protein
gb|AAX91180.1 Bacteriophage 42e     ORF098
gb|ABD31128.1 Staphylococcus aureus subsp. aureus NCTC 8325     phi PVL orf 38-like protein-related protein
gb|ABD31266.1 Staphylococcus aureus subsp. aureus NCTC 8325     phi PVL orf 38-like protein-related protein
gb|ABQ48122.1 Staphylococcus aureus subsp. aureus JH9     protein of unknown function DUF1270
gb|ABR51186.1 Staphylococcus aureus subsp. aureus JH1     protein of unknown function DUF1270
gb|ABS87414.1 Staphylococcus phage tp310-1     hypothetical protein
gb|EES54161.1 Staphylococcus aureus subsp. aureus TCH70     conserved hypothetical protein
gb|EEV74324.1 Staphylococcus aureus A8115     conserved hypothetical protein
gi|147739824 Staphylococcus aureus subsp. aureus JH9 NCBI   protein of unknown function DUF1270
gi|148266755 Staphylococcus aureus subsp. aureus JH9 NCBI   hypothetical protein SaurJH9_0315
gi|149945250 Staphylococcus aureus subsp. aureus JH1 NCBI   protein of unknown function DUF1270
gi|150392798 Staphylococcus aureus subsp. aureus JH1 NCBI   hypothetical protein SaurJH1_0324
gi|154817986 Staphylococcus phage tp310-1 NCBI   hypothetical protein
gi|156603900 Staphylococcus phage tp310-1 NCBI   hypothetical protein SPTP3101_gp11
gi|18920600 Staphylococcus aureus phage phi 13 NCBI   phi PVL orf 38-like protein
gi|21205097 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein
gi|21283656 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein MW1927
gi|221138221 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   hypothetical protein SauraJK_06173
gi|221141538 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   hypothetical protein SauraJ_07848
gi|251801504 Staphylococcus aureus subsp. aureus TCH70 NCBI   conserved hypothetical protein
gi|251814949 Staphylococcus aureus subsp. aureus TCH70 NCBI   conserved hypothetical protein
gi|257850375 Staphylococcus aureus A8115 NCBI   conserved hypothetical protein
gi|258444484 Staphylococcus aureus A8115 NCBI   conserved hypothetical protein
gi|29028676 Staphylococcus phage phi13 NCBI   phi PVL orf 38-like protein
gi|49245245 Staphylococcus aureus subsp. aureus MSSA476 NCBI   putative exported protein
gi|49486802 Staphylococcus aureus subsp. aureus MSSA476 NCBI   hypothetical protein SAS1910
gi|62636069 Bacteriophage 42e NCBI   ORF098
gi|66395576 Staphylococcus phage 42E NCBI   ORF098
gi|87203318 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   phi PVL orf 38-like protein-related protein
gi|87203456 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   phi PVL orf 38-like protein-related protein
gi|88195760 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   phi PVL orf 38-like protein-related protein
gi|88195898 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   phi PVL orf 38-like protein-related protein
img|637158166 Staphylococcus aureus aureus MSSA476 IMG   hypothetical protein
img|637299730 Staphylococcus aureus aureus MW2 IMG   hypothetical protein
img|637894703 Staphylococcus aureus aureus NCTC 8325 IMG   phi PVL orf 38-like protein-related protein
img|637894843 Staphylococcus aureus aureus NCTC 8325 IMG   phi PVL orf 38-like protein-related protein
img|638297106 Staphylococcus aureus phage phi 13 IMG   phi PVL orf 38-like protein
img|638314320 Bacteriophage 42e IMG   ORF098
img|639108330 Staphylococcus aureus aureus JH1 IMG   Protein of unknown function DUF1270
img|640564645 Staphylococcus aureus aureus JH9 IMG   protein of unknown function DUF1270
img|640778394 Staphylococcus aureus aureus JH1 IMG   protein of unknown function DUF1270
img|641209924 Staphylococcus phage tp310-1 provirus IMG   hypothetical protein
kegg|sah:SaurJH1_0324 Staphylococcus aureus subsp. aureus JH1 KEGG   hypothetical protein
kegg|saj:SaurJH9_0315 Staphylococcus aureus subsp. aureus JH9 KEGG   hypothetical protein
kegg|sam:MW1927 Staphylococcus aureus subsp. aureus MW2 KEGG   hypothetical protein
kegg|sao:SAOUHSC_02076 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   phi PVL orf 38-like protein-related protein
kegg|sao:SAOUHSC_02224 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   phi PVL orf 38-like protein-related protein
kegg|sas:SAS1910   KEGG   hypothetical protein
ref|NP_646744.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   hypothetical protein MW1927
ref|NP_803364.1 Staphylococcus phage phi13 RefSeq   phi PVL orf 38-like protein
ref|YP_001245698.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   hypothetical protein SaurJH9_0315
ref|YP_001315473.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   hypothetical protein SaurJH1_0324
ref|YP_001429847.1 Staphylococcus phage tp310-1 RefSeq   hypothetical protein SPTP3101_gp11
ref|YP_044023.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   hypothetical protein SAS1910
ref|YP_239901.1 Staphylococcus phage 42E RefSeq   ORF098
ref|YP_500569.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   phi PVL orf 38-like protein-related protein
ref|YP_500709.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   phi PVL orf 38-like protein-related protein
ref|ZP_03563023.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   hypothetical protein SauraJK_06173
ref|ZP_03566031.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   hypothetical protein SauraJ_07848
ref|ZP_04829422.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   conserved hypothetical protein
ref|ZP_05692817.1 Staphylococcus aureus A8115 RefSeq   conserved hypothetical protein
tr|A5IPJ9 Staphylococcus aureus (strain JH9) TrEMBL   Putative uncharacterized protein precursor
tr|A6TYB8 Staphylococcus aureus (strain JH1) TrEMBL   Putative uncharacterized protein precursor
tr|A7TW97 Staphylococcus phage tp310-1 TrEMBL   Putative uncharacterized protein
tr|C5QKV6 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   Putative uncharacterized protein
tr|Q2FX29 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Phi PVL orf 38-like protein-related protein
tr|Q4ZCX5 Staphylococcus phage 42E TrEMBL   ORF098
tr|Q6G7V0 Staphylococcus aureus (strain MSSA476) TrEMBL   Putative exported protein
tr|Q8NVM8 Staphylococcus aureus (strain MW2) TrEMBL   Putative uncharacterized protein MW1927
tr|Q8SDM7 Staphylococcus phage phi13 (Bacteriophage phi-13) TrEMBL   Phi PVL orf 38-like protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search