The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93061.5.peg.1883: Staphylococcus aureus subsp. aureus NCTC 8325

This feature in The SEED Viewer

NCBI Taxonomy Id: 93061

Current Assignment: Phage protein
Translate Function Assignments



Context on contig NC_007795 from base 1955006 to 1965634 (10629 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1875 1956247 1955006 1242 -           Phage DNA helicase (EC 3.6.4.12) locus|SAOUHSC_02067, protein_id|YP_500560.1, gi|88195751, geneID|3919754
1876 1956600 1956244 357 - -4         Hypothetical protein, SAB1742c homolog [SA bacteriophages 11, Mu50B] locus|SAOUHSC_02068, protein_id|YP_500561.1, gi|88195752, geneID|3919755
1877 1957406 1956600 807 - -1         Phage replication initiation protein locus|SAOUHSC_02069, protein_id|YP_500562.1, gi|88195753, geneID|3919756
1878 1958070 1957378 693 - -29         Phage phi 11 orf14 protein homolog locus|SAOUHSC_02070, protein_id|YP_500563.1, gi|88195754, geneID|3919757
1879 1958637 1958083 555 - 12         Phage ssDNA binding protein locus|SAOUHSC_02071, protein_id|YP_500564.1, gi|88195755, geneID|3919758
1880 1959446 1958667 780 - 29         Phage phi 11 orf12 protein homolog locus|SAOUHSC_02072, protein_id|YP_500565.1, gi|88195756, geneID|3919759
1881 1959983 1959447 537 - 0         Phage phi 11 orf61 protein homolog locus|SAOUHSC_02073, protein_id|YP_500566.1, gi|88195757, geneID|3919760
1882 1960256 1959996 261 - 12         Phage phi 11 orf11 protein homolog locus|SAOUHSC_02074, protein_id|YP_500567.1, gi|88195758, geneID|3919761
1883 1960566 1960237 330 - -20         Phage protein locus|SAOUHSC_02075, protein_id|YP_500568.1, gi|88195759, geneID|3919762
1884 1960817 1960656 162 - 89         Phage phi 11 orf10a protein homolog locus|SAOUHSC_02076, protein_id|YP_500569.1, gi|88195760, geneID|3919763
1885 1961031 1960810 222 - -8         Phage phi 11 orf10 protein homolog locus|SAOUHSC_02077, protein_id|YP_500570.1, gi|88195761, geneID|3919764
1886 1961494 1961045 450 - 13         Phage phi 11 orf9 protein homolog locus|SAOUHSC_02078, protein_id|YP_500571.1, gi|88195762, geneID|3919765
1887 1961760 1961536 225 - 41         Phage phi 11 orf8 protein homolog locus|SAOUHSC_02079, protein_id|YP_500572.1, gi|88195763, geneID|3919766
1888 1962552 1961761 792 - 0         Phage antirepressor protein locus|SAOUHSC_02080, protein_id|YP_500573.1, gi|88195764, geneID|3919767
1889 1963017 1962709 309 - 156         Phage protein locus|SAOUHSC_02081, protein_id|YP_500574.1, gi|88195765, geneID|3919768
1890 1963250 1963032 219 - 14         Phage transcriptional regulator cro locus|SAOUHSC_02083, protein_id|YP_500575.1, gi|88195766, geneID|3919769
1891 1963392 1964111 720 + 141         Phage repressor protein cI locus|SAOUHSC_02084, protein_id|YP_500576.1, gi|88195767, geneID|3919770
1892 1964181 1964348 168 + 69         Phage protein locus|SAOUHSC_02085, protein_id|YP_500577.1, gi|88195768, geneID|3919771
1893 1964508 1964693 186 + 159         Phage phi 11 orf4 protein homolog locus|SAOUHSC_02086, protein_id|YP_500578.1, gi|88195769, geneID|3919772
1894 1964729 1965634 906 + 35         Phage phi 11 orf3 protein homolog locus|SAOUHSC_02087, protein_id|YP_500579.1, gi|88195770, geneID|3919773

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93061.5.peg.1883 Phage protein
MTENIKTEQHYYTKDFSGYRNEEDNFVANQELTVTITLNEYRKLIEIKAVKDKEEDTYRG
KYFAEERKNEKLEKENIKLKNKIYELQNEEDNEEDEEDKEDENDVLQNW

MD5 = 8bbb8f866eb81b266630157dc06c9966


  DNA Sequence

>fig|93061.5.peg.1883 Phage protein
atgactgaaaatattaaaactgaacaacattattacactaaagatttttcaggatacaga
aatgaagaagataactttgtagcaaatcaagaattgacagtaacaatcacattgaacgag
tacagaaaacttattgaaataaaggctgttaaagataaagaagaagatacttacagaggt
aagtattttgcggaagaaagaaaaaacgaaaaattggaaaaagaaaatataaaactaaaa
aacaaaatttatgaattacaaaacgaagaagataacgaggaggacgaagaagacaaggag
gacgagaacgatgtattacaaaattggtga


  DNA with Flanking Sequence

>fig|93061.5.peg.1883 Phage protein
agagaatcaacagttattttaaaggaggaaaagatatgatgaaaaatagtttgcaagcta
aagaacttgcggtaattttatctgtttctaaatccaaagcaggacaaataataagagaac
tgaataaagagcttgaagatgaaggatacattgcgatacgaggcagaataccagtccaat
tagctaggaaaaaattcccttatcacgacttatcagaccagagaataatggaggagttga
aaaaagaaaatgagtaacatttataaaagctacctagtagcagtactatgcttcacagtc
ttagcgattgtacttatgccgtttctatacttcactacagcatggtcaattgcaggattc
gcaagtatcgcaacattcatattctataaggaatacttttatgaagaatgaaaaaactgc
tacttgcgccaacaagtaacaataagtgttcatcaaaatatacaacttaattaaatcaaa
atatacggaggtagtcaactatgactgaaaatattaaaactgaacaacattattacacta
aagatttttcaggatacagaaatgaagaagataactttgtagcaaatcaagaattgacag
taacaatcacattgaacgagtacagaaaacttattgaaataaaggctgttaaagataaag
aagaagatacttacagaggtaagtattttgcggaagaaagaaaaaacgaaaaattggaaa
aagaaaatataaaactaaaaaacaaaatttatgaattacaaaacgaagaagataacgagg
aggacgaagaagacaaggaggacgagaacgatgtattacaaaattggtgagataaaaaac
aaaattataagctttaacgggtttgaatttaaagtgtctgtgatgaagagacatgacggt
atcagtatacaaatcaaggatatgaataatgttccacttaaatcgtttcatgtcatagat
ttaagcgaactatatattgcgacggatgcaatgcgtgacgttataaacgaatggattgaa
aataacacagatgaacaggacaaactaattaacttagtcatgaaatggtaggaggtatga
aaagtgaatgatttacaagagagagaattagaaacattcgaacaagacgaccgattcaaa
gtaactgatctagacagtgctaactgggtttttaagaaactggatgcaatcacaactaaa
gagaatgaaatcaacgatttagcaaataaagaaattgaacgcataaacgaatggaaagat
aaagaagtagaaaaattacagagtggcaaagaatatttacaaagccttgtaattgaatat
tacagaatac


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT05SA1878 Staphylococcus aureus NCTC 8325     conserved hypothetical protein
fig|320849.3.peg.47 Bacteriophage 92 FIG   Phage protein
fig|93061.3.peg.1960 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Phage protein
gb|AAX91976.1 Bacteriophage 92     ORF047
gb|ABD31127.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical phage protein
gi|62636865 Bacteriophage 92 NCBI   ORF047
gi|66396451 Staphylococcus phage 92 NCBI   ORF047
gi|87203317 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical phage protein
gi|88195759 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_02075
img|637894702 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|638315206 Bacteriophage 92 IMG   ORF047
kegg|sao:SAOUHSC_02075 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
ref|YP_240787.1 Staphylococcus phage 92 RefSeq   ORF047
ref|YP_500568.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_02075
tr|Q2FX30 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Conserved hypothetical phage protein
tr|Q4ZAD9 Staphylococcus phage 92 TrEMBL   ORF047


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search