The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93061.5.peg.1879: Staphylococcus aureus subsp. aureus NCTC 8325

This feature in The SEED Viewer

NCBI Taxonomy Id: 93061

Current Assignment: Phage ssDNA binding protein
Translate Function Assignments



Context on contig NC_007795 from base 1953085 to 1964111 (11027 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1868 1953333 1953085 249 -           Phage phi 11 orf22 protein homolog locus|SAOUHSC_02060, protein_id|YP_500553.1, gi|88195744, geneID|3919747
1869 1953693 1953334 360 - 0         Phage phi 11 orf21 protein homolog locus|SAOUHSC_02061, protein_id|YP_500554.1, gi|88195745, geneID|3919748
1870 1953963 1953694 270 - 0         Phage transcriptional regulator cro locus|SAOUHSC_02062, protein_id|YP_500555.1, gi|88195746, geneID|3919749
1871 1954149 1953964 186 - 0         Phage phi 11 orf19 protein homolog locus|SAOUHSC_02063, protein_id|YP_500556.1, gi|88195747, geneID|3919750
1872 1954558 1954154 405 - 4         Phage phi 11 orf18 protein homolog locus|SAOUHSC_02064, protein_id|YP_500557.1, gi|88195748, geneID|3919751
1873 1954790 1954569 222 - 10         Phage phi 11 orf17 protein homolog locus|SAOUHSC_02065, protein_id|YP_500558.1, gi|88195749, geneID|3919752
1874 1954973 1954794 180 - 3         Phage protein locus|SAOUHSC_02066, protein_id|YP_500559.1, gi|88195750, geneID|3919753
1875 1956247 1955006 1242 - 32         Phage DNA helicase (EC 3.6.4.12) locus|SAOUHSC_02067, protein_id|YP_500560.1, gi|88195751, geneID|3919754
1876 1956600 1956244 357 - -4         Hypothetical protein, SAB1742c homolog [SA bacteriophages 11, Mu50B] locus|SAOUHSC_02068, protein_id|YP_500561.1, gi|88195752, geneID|3919755
1877 1957406 1956600 807 - -1         Phage replication initiation protein locus|SAOUHSC_02069, protein_id|YP_500562.1, gi|88195753, geneID|3919756
1878 1958070 1957378 693 - -29         Phage phi 11 orf14 protein homolog locus|SAOUHSC_02070, protein_id|YP_500563.1, gi|88195754, geneID|3919757
1879 1958637 1958083 555 - 12         Phage ssDNA binding protein locus|SAOUHSC_02071, protein_id|YP_500564.1, gi|88195755, geneID|3919758
1880 1959446 1958667 780 - 29         Phage phi 11 orf12 protein homolog locus|SAOUHSC_02072, protein_id|YP_500565.1, gi|88195756, geneID|3919759
1881 1959983 1959447 537 - 0         Phage phi 11 orf61 protein homolog locus|SAOUHSC_02073, protein_id|YP_500566.1, gi|88195757, geneID|3919760
1882 1960256 1959996 261 - 12         Phage phi 11 orf11 protein homolog locus|SAOUHSC_02074, protein_id|YP_500567.1, gi|88195758, geneID|3919761
1883 1960566 1960237 330 - -20         Phage protein locus|SAOUHSC_02075, protein_id|YP_500568.1, gi|88195759, geneID|3919762
1884 1960817 1960656 162 - 89         Phage phi 11 orf10a protein homolog locus|SAOUHSC_02076, protein_id|YP_500569.1, gi|88195760, geneID|3919763
1885 1961031 1960810 222 - -8         Phage phi 11 orf10 protein homolog locus|SAOUHSC_02077, protein_id|YP_500570.1, gi|88195761, geneID|3919764
1886 1961494 1961045 450 - 13         Phage phi 11 orf9 protein homolog locus|SAOUHSC_02078, protein_id|YP_500571.1, gi|88195762, geneID|3919765
1887 1961760 1961536 225 - 41         Phage phi 11 orf8 protein homolog locus|SAOUHSC_02079, protein_id|YP_500572.1, gi|88195763, geneID|3919766
1888 1962552 1961761 792 - 0         Phage antirepressor protein locus|SAOUHSC_02080, protein_id|YP_500573.1, gi|88195764, geneID|3919767
1889 1963017 1962709 309 - 156         Phage protein locus|SAOUHSC_02081, protein_id|YP_500574.1, gi|88195765, geneID|3919768
1890 1963250 1963032 219 - 14         Phage transcriptional regulator cro locus|SAOUHSC_02083, protein_id|YP_500575.1, gi|88195766, geneID|3919769
1891 1963392 1964111 720 + 141         Phage repressor protein cI locus|SAOUHSC_02084, protein_id|YP_500576.1, gi|88195767, geneID|3919770

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93061.5.peg.1879 Phage ssDNA binding protein
MKITGRTQYIQETNQEAFMKGGDFLGAGEFTVKVANVEFNDRENRYFTIVFENNEGKQYK
HNQFVPPFQQDYQEKQYIELLSRLGIKLNLPDLTFDTDQLINKIGTIVLKNKFNEEQGKY
FVRLSYVKVWNKDDEVVNKPEPKTDEMKQKEQQANGKQTPMSQQSNPFANANGPIEINDD
DLPF

MD5 = b384438b802fce7a0452b13b3981301f


  DNA Sequence

>fig|93061.5.peg.1879 Phage ssDNA binding protein
atgaaaatcactggtagaacacaatacattcaagaaactaatcaagaggcattcatgaaa
ggtggggactttttaggagctggagaatttacagtaaaagttgcaaatgtcgagtttaac
gacagagaaaacagatacttcacgattgtttttgaaaacaacgaaggtaaacaatacaaa
cacaaccaattcgtcccaccattccaacaagattatcaagaaaaacaatatatcgagtta
cttagtagattaggaattaaattgaacttaccagatttaacttttgacacagatcaatta
attaacaaaatcggaactattgtacttaaaaataaatttaacgaggaacaaggcaagtat
tttgtaagactctcatatgtaaaagtttggaataaagacgatgaagtagttaataaacca
gaacctaaaactgatgagatgaaacaaaaagaacagcaagcaaatgggaaacagacgcca
atgagtcaacaatcaaacccattcgctaatgctaatggtccaatagaaatcaatgatgat
gatttaccgttctag


  DNA with Flanking Sequence

>fig|93061.5.peg.1879 Phage ssDNA binding protein
attgaaacaatccaaaagttacgtgatatcactatggacgacatcatggacggtaaatca
aagaaaccgacatttaatgattggggcgagtgtgctacacgcattgtaagtatttatcgt
tatatttctaaattacaagaacattatcaatttcatcttgctataagcggacacgagggc
attaacaaagacaaagatgatgagggaagtactatcaatccaacaatcacgatagaggca
caagaccaaataaaaaaagcagtcatcagtcaatctgacgtgttagcaagaatgacaata
gaagaacatgagcaagacggcgaaaaaacttatcaatatgtacttaacgctgaaccatca
aatttattcgagacaaagataagacactcaagcaacatcaaaattaacaacaaacgtttc
attaatccaagtattaacgatgttgtacaagcaattagaaatggtaattaaaaattaatt
aaaaggacggtataaaaattatgaaaatcactggtagaacacaatacattcaagaaacta
atcaagaggcattcatgaaaggtggggactttttaggagctggagaatttacagtaaaag
ttgcaaatgtcgagtttaacgacagagaaaacagatacttcacgattgtttttgaaaaca
acgaaggtaaacaatacaaacacaaccaattcgtcccaccattccaacaagattatcaag
aaaaacaatatatcgagttacttagtagattaggaattaaattgaacttaccagatttaa
cttttgacacagatcaattaattaacaaaatcggaactattgtacttaaaaataaattta
acgaggaacaaggcaagtattttgtaagactctcatatgtaaaagtttggaataaagacg
atgaagtagttaataaaccagaacctaaaactgatgagatgaaacaaaaagaacagcaag
caaatgggaaacagacgccaatgagtcaacaatcaaacccattcgctaatgctaatggtc
caatagaaatcaatgatgatgatttaccgttctaggacgtggtttaaatgcaatacatta
caagataccagaaagacaatgacggtacttattccgtcgttgctactggtgttgaacttg
aacaaagtcacattgacttactagaaaacggatatccactaaaagcagaagtagaggttc
cggacaataaaaaactatctatagaacaacgcaaaaaaatattcgcaatgtgtagagata
tagaacttcactggggcgaaccagtagaatcaactagaaaattattacaaacagaattgg
aaattatgaaaggttatgaagaaatcagtctgcgcgactgttctatgaaagttgcaaggg
agttaatagaactgattatagcgtttatgtttcatcatcaaatacctatgagtgtagaaa
cgagtaagttgttaagcgaagataaagcgttattatattgggctacaatcaaccgcaact
gtgtaatatgcggaaagcctcacgcagacctggcacattatgaagcagtcggcag


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT05SA1874 Staphylococcus aureus NCTC 8325     conserved hypothetical protein
fig|12360.1.peg.13 Staphylococcus aureus phage phi 11 FIG   Phage ssDNA binding protein
fig|320842.3.peg.24 Bacteriophage 96 FIG   Phage ssDNA binding protein
fig|320847.3.peg.31 Bacteriophage 52A FIG   Phage ssDNA binding protein
fig|405947.2.peg.14 Siphoviridae Staphylococcus phage 80 FIG   Phage ssDNA binding protein
fig|445517.2.peg.16 Viruses Staphylococcus phage tp310-3 Viruses. FIG   Phage ssDNA binding protein
fig|452948.4.peg.2691 Staphylococcus aureus 930918-3 FIG   Phage ssDNA binding protein
fig|553588.3.peg.592 Staphylococcus aureus A9719 FIG   Phage ssDNA binding protein
fig|553594.3.peg.2734 Staphylococcus aureus A9765 FIG   Phage ssDNA binding protein
fig|553596.3.peg.2722 Staphylococcus aureus A9781 FIG   Phage ssDNA binding protein
fig|585143.3.peg.2554 Staphylococcus aureus subsp. aureus 55/2053 FIG   Phage ssDNA binding protein
fig|585144.3.peg.2562 Staphylococcus aureus subsp. aureus 58-424 FIG   Phage ssDNA binding protein
fig|585145.3.peg.2552 Staphylococcus aureus subsp. aureus 65-1322 FIG   Phage ssDNA binding protein
fig|585146.3.peg.2534 Staphylococcus aureus subsp. aureus 68-397 FIG   Phage ssDNA binding protein
fig|585149.6.peg.2172 Staphylococcus aureus subsp. aureus C101 FIG   Phage ssDNA binding protein
fig|585151.3.peg.1547 Staphylococcus aureus subsp. aureus C427 FIG   Phage ssDNA binding protein
fig|585153.3.peg.2619 Staphylococcus aureus subsp. aureus E1410 FIG   Phage ssDNA binding protein
fig|585156.3.peg.1552 Staphylococcus aureus subsp. aureus M1015 FIG   Phage ssDNA binding protein
fig|585157.3.peg.1667 Staphylococcus aureus subsp. aureus M809 FIG   Phage ssDNA binding protein
fig|585158.3.peg.2537 Staphylococcus aureus subsp. aureus M876 FIG   Phage ssDNA binding protein
fig|585159.3.peg.2103 Staphylococcus aureus subsp. aureus M899 FIG   Phage ssDNA binding protein
fig|648017.2.peg.19 Viruses Staphylococcus phage phiPVL-CN125 Viruses. FIG   Phage ssDNA binding protein
fig|680649.3.peg.2345 Staphylococcus aureus subsp. aureus MR1 FIG   Phage ssDNA binding protein
gb|AAL82241.1 Staphylococcus aureus phage phi 11     ssb
gb|AAX91438.1 Bacteriophage 96     ORF021
gb|AAX91816.1 Bacteriophage 52A     ORF022
gb|ABJ88862.1 Staphylococcus phage 80     conserved putative SSB
gb|ABS87545.1 Staphylococcus phage tp310-3     hypothetical protein
gb|ACR54205.1 Staphylococcus phage phiPVL-CN125     single strand DNA binding protein
gb|EEV03217.1 Staphylococcus aureus subsp. aureus 55/2053     conserved hypothetical protein
gb|EEV05956.1 Staphylococcus aureus subsp. aureus 65-1322     single-strand DNA-binding protein
gb|EEV08521.1 Staphylococcus aureus subsp. aureus 68-397     single-strand DNA-binding protein
gb|EEV11192.1 Staphylococcus aureus subsp. aureus E1410     single-strand DNA-binding protein
gb|EEV13753.1 Staphylococcus aureus subsp. aureus M876     single-strand DNA-binding protein
gb|EEV28099.1 Staphylococcus aureus A9781     conserved hypothetical protein
gb|EEV68150.1 Staphylococcus aureus A9719     conserved hypothetical protein
gi|116235527 Staphylococcus phage 80 NCBI   conserved putative SSB
gi|154818119 Staphylococcus phage tp310-3 NCBI   hypothetical protein
gi|156604033 Staphylococcus phage tp310-3 NCBI   hypothetical protein SPTP3103_gp16
gi|18920500 Staphylococcus aureus phage phi 11 NCBI   ssb
gi|238684002 Staphylococcus phage phiPVL-CN125 NCBI   single strand DNA binding protein
gi|239507377 Staphylococcus phage phiPVL-CN125 NCBI   single strand DNA binding protein
gi|257271048 Staphylococcus aureus subsp. aureus 55/2053 NCBI   conserved hypothetical protein
gi|257274444 Staphylococcus aureus subsp. aureus 65-1322 NCBI   single-strand DNA-binding protein
gi|257277857 Staphylococcus aureus subsp. aureus 68-397 NCBI   single-strand DNA-binding protein
gi|257281048 Staphylococcus aureus subsp. aureus E1410 NCBI   single-strand DNA-binding protein
gi|257283627 Staphylococcus aureus subsp. aureus M876 NCBI   single-strand DNA-binding protein
gi|257426140 Staphylococcus aureus subsp. aureus 55/2053 NCBI   conserved hypothetical protein
gi|257428800 Staphylococcus aureus subsp. aureus 65-1322 NCBI   single-strand DNA-binding protein
gi|257431411 Staphylococcus aureus subsp. aureus 68-397 NCBI   single-strand DNA-binding protein
gi|257434122 Staphylococcus aureus subsp. aureus E1410 NCBI   single-strand DNA-binding protein
gi|257437033 Staphylococcus aureus subsp. aureus M876 NCBI   single-strand DNA-binding protein
gi|257789759 Staphylococcus aureus A9781 NCBI   conserved hypothetical protein
gi|257795787 Staphylococcus aureus A9781 NCBI   conserved hypothetical protein
gi|257843752 Staphylococcus aureus A9719 NCBI   conserved hypothetical protein
gi|258420263 Staphylococcus aureus A9719 NCBI   conserved hypothetical protein
gi|29028576 Staphylococcus phage 11 NCBI   ssb
gi|62636327 Bacteriophage 96 NCBI   ORF021
gi|62636705 Bacteriophage 52A NCBI   ORF022
gi|66395906 Staphylococcus phage 96 NCBI   ORF021
gi|66396289 Staphylococcus phage 52A NCBI   ORF022
img|638297008 Staphylococcus phage 11 IMG   ssb
img|638314695 Bacteriophage 96 IMG   ORF021
img|638315071 Bacteriophage 52A IMG   ORF022
img|641210055 Staphylococcus phage tp310-3 provirus IMG   hypothetical protein
ref|NP_803266.1 Staphylococcus phage 11 RefSeq   ssb
ref|YP_001429978.1 Staphylococcus phage tp310-3 RefSeq   hypothetical protein SPTP3103_gp16
ref|YP_002939687.1 Staphylococcus phage phiPVL-CN125 RefSeq   single strand DNA binding protein
ref|YP_240276.1 Staphylococcus phage 96 RefSeq   ORF021
ref|YP_240652.1 Staphylococcus phage 52A RefSeq   ORF022
ref|ZP_05602556.1 Staphylococcus aureus subsp. aureus 55/2053 RefSeq   conserved hypothetical protein
ref|ZP_05605195.1 Staphylococcus aureus subsp. aureus 65-1322 RefSeq   single-strand DNA-binding protein
ref|ZP_05607785.1 Staphylococcus aureus subsp. aureus 68-397 RefSeq   single-strand DNA-binding protein
ref|ZP_05610473.1 Staphylococcus aureus subsp. aureus E1410 RefSeq   single-strand DNA-binding protein
ref|ZP_05613074.1 Staphylococcus aureus subsp. aureus M876 RefSeq   single-strand DNA-binding protein
ref|ZP_05644766.1 Staphylococcus aureus A9781 RefSeq   conserved hypothetical protein
ref|ZP_05683214.1 Staphylococcus aureus A9719 RefSeq   conserved hypothetical protein
tr|A7TWM8 Staphylococcus phage tp310-3 TrEMBL   Putative uncharacterized protein
tr|A7YGQ6 Staphylococcus phage 80 TrEMBL   Conserved putative SSB
tr|C5I640 Staphylococcus phage phiPVL-CN125 TrEMBL   Single strand DNA binding protein
tr|Q4ZAS4 Staphylococcus phage 52A TrEMBL   ORF022
tr|Q4ZBV0 Staphylococcus phage 96 TrEMBL   ORF021
tr|Q8SDW4 Staphylococcus phage phi11 (Bacteriophage phi-11) TrEMBL   Ssb


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search