The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93061.5.peg.1878: Staphylococcus aureus subsp. aureus NCTC 8325

This feature in The SEED Viewer

NCBI Taxonomy Id: 93061

Current Assignment: Phage phi 11 orf14 protein homolog
Translate Function Assignments



Context on contig NC_007795 from base 1952084 to 1963250 (11167 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1865 1952593 1952084 510 -           Phage deoxyuridine 5'-triphosphate nucleotidohydrolase (EC 3.6.1.23) locus|SAOUHSC_02057, protein_id|YP_500550.1, gi|88195741, geneID|3919744
1866 1952828 1952586 243 - -8         Phage protein locus|SAOUHSC_02058, protein_id|YP_500551.1, gi|88195742, geneID|3919745
1867 1953073 1952825 249 - -4         hypothetical protein locus|SAOUHSC_02059, protein_id|YP_500552.1, gi|88195743, geneID|3919746
1868 1953333 1953085 249 - 11         Phage phi 11 orf22 protein homolog locus|SAOUHSC_02060, protein_id|YP_500553.1, gi|88195744, geneID|3919747
1869 1953693 1953334 360 - 0         Phage phi 11 orf21 protein homolog locus|SAOUHSC_02061, protein_id|YP_500554.1, gi|88195745, geneID|3919748
1870 1953963 1953694 270 - 0         Phage transcriptional regulator cro locus|SAOUHSC_02062, protein_id|YP_500555.1, gi|88195746, geneID|3919749
1871 1954149 1953964 186 - 0         Phage phi 11 orf19 protein homolog locus|SAOUHSC_02063, protein_id|YP_500556.1, gi|88195747, geneID|3919750
1872 1954558 1954154 405 - 4         Phage phi 11 orf18 protein homolog locus|SAOUHSC_02064, protein_id|YP_500557.1, gi|88195748, geneID|3919751
1873 1954790 1954569 222 - 10         Phage phi 11 orf17 protein homolog locus|SAOUHSC_02065, protein_id|YP_500558.1, gi|88195749, geneID|3919752
1874 1954973 1954794 180 - 3         Phage protein locus|SAOUHSC_02066, protein_id|YP_500559.1, gi|88195750, geneID|3919753
1875 1956247 1955006 1242 - 32         Phage DNA helicase (EC 3.6.4.12) locus|SAOUHSC_02067, protein_id|YP_500560.1, gi|88195751, geneID|3919754
1876 1956600 1956244 357 - -4         Hypothetical protein, SAB1742c homolog [SA bacteriophages 11, Mu50B] locus|SAOUHSC_02068, protein_id|YP_500561.1, gi|88195752, geneID|3919755
1877 1957406 1956600 807 - -1         Phage replication initiation protein locus|SAOUHSC_02069, protein_id|YP_500562.1, gi|88195753, geneID|3919756
1878 1958070 1957378 693 - -29         Phage phi 11 orf14 protein homolog locus|SAOUHSC_02070, protein_id|YP_500563.1, gi|88195754, geneID|3919757
1879 1958637 1958083 555 - 12         Phage ssDNA binding protein locus|SAOUHSC_02071, protein_id|YP_500564.1, gi|88195755, geneID|3919758
1880 1959446 1958667 780 - 29         Phage phi 11 orf12 protein homolog locus|SAOUHSC_02072, protein_id|YP_500565.1, gi|88195756, geneID|3919759
1881 1959983 1959447 537 - 0         Phage phi 11 orf61 protein homolog locus|SAOUHSC_02073, protein_id|YP_500566.1, gi|88195757, geneID|3919760
1882 1960256 1959996 261 - 12         Phage phi 11 orf11 protein homolog locus|SAOUHSC_02074, protein_id|YP_500567.1, gi|88195758, geneID|3919761
1883 1960566 1960237 330 - -20         Phage protein locus|SAOUHSC_02075, protein_id|YP_500568.1, gi|88195759, geneID|3919762
1884 1960817 1960656 162 - 89         Phage phi 11 orf10a protein homolog locus|SAOUHSC_02076, protein_id|YP_500569.1, gi|88195760, geneID|3919763
1885 1961031 1960810 222 - -8         Phage phi 11 orf10 protein homolog locus|SAOUHSC_02077, protein_id|YP_500570.1, gi|88195761, geneID|3919764
1886 1961494 1961045 450 - 13         Phage phi 11 orf9 protein homolog locus|SAOUHSC_02078, protein_id|YP_500571.1, gi|88195762, geneID|3919765
1887 1961760 1961536 225 - 41         Phage phi 11 orf8 protein homolog locus|SAOUHSC_02079, protein_id|YP_500572.1, gi|88195763, geneID|3919766
1888 1962552 1961761 792 - 0         Phage antirepressor protein locus|SAOUHSC_02080, protein_id|YP_500573.1, gi|88195764, geneID|3919767
1889 1963017 1962709 309 - 156         Phage protein locus|SAOUHSC_02081, protein_id|YP_500574.1, gi|88195765, geneID|3919768
1890 1963250 1963032 219 - 14         Phage transcriptional regulator cro locus|SAOUHSC_02083, protein_id|YP_500575.1, gi|88195766, geneID|3919769

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93061.5.peg.1878 Phage phi 11 orf14 protein homolog
MQYITRYQKDNDGTYSVVATGVELEQSHIDLLENGYPLKAEVEVPDNKKLSIEQRKKIFA
MCRDIELHWGEPVESTRKLLQTELEIMKGYEEISLRDCSMKVARELIELIIAFMFHHQIP
MSVETSKLLSEDKALLYWATINRNCVICGKPHADLAHYEAVGRGMNRNKMNHYDKHVLAL
CRQHHNEQHAIGVKSFDDKYHLHDSWIKVDERLNKMLKGENNGRSIVDKT

MD5 = 4c91b4261667be7341b9177c2f60f375


  DNA Sequence

>fig|93061.5.peg.1878 Phage phi 11 orf14 protein homolog
atgcaatacattacaagataccagaaagacaatgacggtacttattccgtcgttgctact
ggtgttgaacttgaacaaagtcacattgacttactagaaaacggatatccactaaaagca
gaagtagaggttccggacaataaaaaactatctatagaacaacgcaaaaaaatattcgca
atgtgtagagatatagaacttcactggggcgaaccagtagaatcaactagaaaattatta
caaacagaattggaaattatgaaaggttatgaagaaatcagtctgcgcgactgttctatg
aaagttgcaagggagttaatagaactgattatagcgtttatgtttcatcatcaaatacct
atgagtgtagaaacgagtaagttgttaagcgaagataaagcgttattatattgggctaca
atcaaccgcaactgtgtaatatgcggaaagcctcacgcagacctggcacattatgaagca
gtcggcagaggcatgaacagaaacaaaatgaatcactacgacaaacatgtgttagcactg
tgtagacaacatcataatgaacagcacgcaattggcgttaagtcgtttgatgataaatat
cacttgcatgactcgtggataaaagttgatgagaggctcaacaaaatgctgaaaggagaa
aacaatgggagaagtatcgtggataaaacttaa


  DNA with Flanking Sequence

>fig|93061.5.peg.1878 Phage phi 11 orf14 protein homolog
actttttaggagctggagaatttacagtaaaagttgcaaatgtcgagtttaacgacagag
aaaacagatacttcacgattgtttttgaaaacaacgaaggtaaacaatacaaacacaacc
aattcgtcccaccattccaacaagattatcaagaaaaacaatatatcgagttacttagta
gattaggaattaaattgaacttaccagatttaacttttgacacagatcaattaattaaca
aaatcggaactattgtacttaaaaataaatttaacgaggaacaaggcaagtattttgtaa
gactctcatatgtaaaagtttggaataaagacgatgaagtagttaataaaccagaaccta
aaactgatgagatgaaacaaaaagaacagcaagcaaatgggaaacagacgccaatgagtc
aacaatcaaacccattcgctaatgctaatggtccaatagaaatcaatgatgatgatttac
cgttctaggacgtggtttaaatgcaatacattacaagataccagaaagacaatgacggta
cttattccgtcgttgctactggtgttgaacttgaacaaagtcacattgacttactagaaa
acggatatccactaaaagcagaagtagaggttccggacaataaaaaactatctatagaac
aacgcaaaaaaatattcgcaatgtgtagagatatagaacttcactggggcgaaccagtag
aatcaactagaaaattattacaaacagaattggaaattatgaaaggttatgaagaaatca
gtctgcgcgactgttctatgaaagttgcaagggagttaatagaactgattatagcgttta
tgtttcatcatcaaatacctatgagtgtagaaacgagtaagttgttaagcgaagataaag
cgttattatattgggctacaatcaaccgcaactgtgtaatatgcggaaagcctcacgcag
acctggcacattatgaagcagtcggcagaggcatgaacagaaacaaaatgaatcactacg
acaaacatgtgttagcactgtgtagacaacatcataatgaacagcacgcaattggcgtta
agtcgtttgatgataaatatcacttgcatgactcgtggataaaagttgatgagaggctca
acaaaatgctgaaaggagaaaacaatgggagaagtatcgtggataaaacttaaagttggc
atgtttgatgacagcaaaatcaaatatatcgaagctttacccgaaagagatacgatcata
actatttgggttaagttactaactttatcaggaaagtacaatgaacaaggttatattatg
ctatccgaaaacttgccgtacaacgaagaaatgttagcaaatgaatttaatagacctatt
aactcaataaggttagcaattcaaacttttgagacattgggcatgattgaaaaagttaat
ggtgtcataaaagtgacaaactgggagaagcatcaaagcttagatagcaaagctaagcat
aaagaaaaaaataaattgcgacaacaacgctatcgtgagaaacagaaaaagttactagaa
gcaaaacgtaacgttaccgtaacgttacgtaacgatacagaagaagaagaagaaagagaa
gaagaaaaagaagaagaatataagaataaagaagaagaaagagaagccgtcttctcatct
tcaataaaatata


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT05SA1873 Staphylococcus aureus NCTC 8325     77ORF018
fig|12360.1.peg.14 Staphylococcus aureus phage phi 11 FIG   Phage phi 11 orf14 protein homolog
fig|93061.3.peg.1955 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Phage phi 11 orf14 protein homolog
gb|AAL82242.1 Staphylococcus aureus phage phi 11     phi PV83 orf 19-like protein
gb|ABD31122.1 Staphylococcus aureus subsp. aureus NCTC 8325     phi PV83 orf 19-like protein
gi|18920501 Staphylococcus aureus phage phi 11 NCBI   phi PV83 orf 19-like protein
gi|29028577 Staphylococcus phage 11 NCBI   phi PV83 orf 19-like protein
gi|87203312 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   phi PV83 orf 19-like protein
gi|88195754 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   phi PV83 orf 19-like protein
img|637894697 Staphylococcus aureus aureus NCTC 8325 IMG   phi PV83 orf 19-like protein
img|638297009 Staphylococcus phage 11 IMG   phi PV83 orf 19-like protein
kegg|sao:SAOUHSC_02070 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   phi PV83 orf 19-like protein
ref|NP_803267.1 Staphylococcus phage 11 RefSeq   phi PV83 orf 19-like protein
ref|YP_500563.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   phi PV83 orf 19-like protein
tr|Q2FUP5 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Phi PV83 orf 19-like protein
tr|Q8SDW3 Staphylococcus phage phi11 (Bacteriophage phi-11) TrEMBL   Phi PV83 orf 19-like protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search