The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93061.5.peg.1875: Staphylococcus aureus subsp. aureus NCTC 8325

This feature in The SEED Viewer

NCBI Taxonomy Id: 93061

Current Assignment: Phage DNA helicase (EC 3.6.4.12)
Translate Function Assignments



Context on contig NC_007795 from base 1948782 to 1961494 (12713 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1857 1950059 1948782 1278 -           Phage terminase, large subunit locus|SAOUHSC_02049, protein_id|YP_500542.1, gi|88195733, geneID|3920499
1858 1950486 1950046 441 - -14         Phage terminase, small subunit locus|SAOUHSC_02050, protein_id|YP_500543.1, gi|88195734, geneID|3920500
1859 1951095 1950673 423 - 186         Phage integrase regulator RinA locus|SAOUHSC_02051, protein_id|YP_500544.1, gi|88195735, geneID|3920501
1860 1951265 1951119 147 - 23         Phage protein ORF120 locus|SAOUHSC_02052, protein_id|YP_500545.1, gi|88195736, geneID|3920502
1861 1951439 1951266 174 - 0         Transcriptional activator rinB, phage associated locus|SAOUHSC_02053, protein_id|YP_500546.1, gi|88195737, geneID|3919740
1862 1951642 1951442 201 - 2         hypothetical protein locus|SAOUHSC_02054, protein_id|YP_500547.1, gi|88195738, geneID|3919741
1863 1951805 1951617 189 - -26         Phage phi 11 orf26a protein homolog locus|SAOUHSC_02055, protein_id|YP_500548.1, gi|88195739, geneID|3919742
1864 1952047 1951802 246 - -4         Hypothetical protein, SLT orf81b homolog [SA bacteriophages 11, Mu50B] locus|SAOUHSC_02056, protein_id|YP_500549.1, gi|88195740, geneID|3919743
1865 1952593 1952084 510 - 36         Phage deoxyuridine 5'-triphosphate nucleotidohydrolase (EC 3.6.1.23) locus|SAOUHSC_02057, protein_id|YP_500550.1, gi|88195741, geneID|3919744
1866 1952828 1952586 243 - -8         Phage protein locus|SAOUHSC_02058, protein_id|YP_500551.1, gi|88195742, geneID|3919745
1867 1953073 1952825 249 - -4         hypothetical protein locus|SAOUHSC_02059, protein_id|YP_500552.1, gi|88195743, geneID|3919746
1868 1953333 1953085 249 - 11         Phage phi 11 orf22 protein homolog locus|SAOUHSC_02060, protein_id|YP_500553.1, gi|88195744, geneID|3919747
1869 1953693 1953334 360 - 0         Phage phi 11 orf21 protein homolog locus|SAOUHSC_02061, protein_id|YP_500554.1, gi|88195745, geneID|3919748
1870 1953963 1953694 270 - 0         Phage transcriptional regulator cro locus|SAOUHSC_02062, protein_id|YP_500555.1, gi|88195746, geneID|3919749
1871 1954149 1953964 186 - 0         Phage phi 11 orf19 protein homolog locus|SAOUHSC_02063, protein_id|YP_500556.1, gi|88195747, geneID|3919750
1872 1954558 1954154 405 - 4         Phage phi 11 orf18 protein homolog locus|SAOUHSC_02064, protein_id|YP_500557.1, gi|88195748, geneID|3919751
1873 1954790 1954569 222 - 10         Phage phi 11 orf17 protein homolog locus|SAOUHSC_02065, protein_id|YP_500558.1, gi|88195749, geneID|3919752
1874 1954973 1954794 180 - 3         Phage protein locus|SAOUHSC_02066, protein_id|YP_500559.1, gi|88195750, geneID|3919753
1875 1956247 1955006 1242 - 32         Phage DNA helicase (EC 3.6.4.12) locus|SAOUHSC_02067, protein_id|YP_500560.1, gi|88195751, geneID|3919754
1876 1956600 1956244 357 - -4         Hypothetical protein, SAB1742c homolog [SA bacteriophages 11, Mu50B] locus|SAOUHSC_02068, protein_id|YP_500561.1, gi|88195752, geneID|3919755
1877 1957406 1956600 807 - -1         Phage replication initiation protein locus|SAOUHSC_02069, protein_id|YP_500562.1, gi|88195753, geneID|3919756
1878 1958070 1957378 693 - -29         Phage phi 11 orf14 protein homolog locus|SAOUHSC_02070, protein_id|YP_500563.1, gi|88195754, geneID|3919757
1879 1958637 1958083 555 - 12         Phage ssDNA binding protein locus|SAOUHSC_02071, protein_id|YP_500564.1, gi|88195755, geneID|3919758
1880 1959446 1958667 780 - 29         Phage phi 11 orf12 protein homolog locus|SAOUHSC_02072, protein_id|YP_500565.1, gi|88195756, geneID|3919759
1881 1959983 1959447 537 - 0         Phage phi 11 orf61 protein homolog locus|SAOUHSC_02073, protein_id|YP_500566.1, gi|88195757, geneID|3919760
1882 1960256 1959996 261 - 12         Phage phi 11 orf11 protein homolog locus|SAOUHSC_02074, protein_id|YP_500567.1, gi|88195758, geneID|3919761
1883 1960566 1960237 330 - -20         Phage protein locus|SAOUHSC_02075, protein_id|YP_500568.1, gi|88195759, geneID|3919762
1884 1960817 1960656 162 - 89         Phage phi 11 orf10a protein homolog locus|SAOUHSC_02076, protein_id|YP_500569.1, gi|88195760, geneID|3919763
1885 1961031 1960810 222 - -8         Phage phi 11 orf10 protein homolog locus|SAOUHSC_02077, protein_id|YP_500570.1, gi|88195761, geneID|3919764
1886 1961494 1961045 450 - 13         Phage phi 11 orf9 protein homolog locus|SAOUHSC_02078, protein_id|YP_500571.1, gi|88195762, geneID|3919765

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93061.5.peg.1875 Phage DNA helicase (EC 3.6.4.12)
MNYGQFEIESTIIATLLKQPDVLEKIRVKDYMFTNEKFKTFFNYVMDVGKIDHQEIYLKA
TKDKEFLDADTITKLYNSDFIGYGFFERYQQELLESYQLNKANELVTEFKQQPTNQNFNN
LIDELKDLKTITNKKEDGTKKFVEEFVEELYSDSPKKQIKTGYKLMDYKIGGLEPSQLIV
IAARPSVGKTGFALNMMLNIAQNGYKTSFFSLETTGTSVLKRMLSTITGIELTKIKEIRN
LTPDDLTKLTNAMDKIMKLGIDISDKSNITPQDVRAQAMRHSDRQQVIFIDYLQLMDTDA
KVDRRVAVEKISRDLKIIANETGAIIVLLSQLNRGVESRQDKRPMLSDMKESGGIEADAS
LAMLLYRDDYYNRDEDDSITGKSIVECNIAKNKDGETGIIEFEYYKKTQRFFT

MD5 = 2f60c05664cce42f18d2babc8fcea5f5


  DNA Sequence

>fig|93061.5.peg.1875 Phage DNA helicase (EC 3.6.4.12)
atgaattacggacaattcgaaattgaaagtacaataatcgctacgctacttaaacaaccg
gacgtattagaaaagataagagttaaagattacatgtttacgaacgaaaagtttaaaacc
tttttcaattatgtaatggacgtcggaaagatagatcatcaagaaatctatttaaaagca
actaaagataaagaatttttagatgcagatactataactaaactttacaactccgatttc
attggatatggcttctttgaacgttatcaacaagaattattggaaagttatcagctcaac
aaagctaacgaattggtaactgagttcaaacaacaacctacgaaccaaaactttaacaac
ttgattgatgaactcaaggatttaaaaacaattactaacaaaaaagaagatggaaccaag
aagtttgttgaggagtttgtcgaagagttatacagcgatagccctaagaagcaaattaag
acgggttacaagctaatggattacaaaatagggggattagaaccatcacaattaatcgtc
atcgcagcgcgtccctcagtgggtaagacaggttttgcattaaacatgatgctgaacata
gcacaaaatggatacaaaacatctttctttagtctcgaaacaaccggcacatcggtattg
aaacgtatgttatcaacaattactggtattgagttaacaaagataaaagaaatcaggaac
ttaacgccggatgacttaacaaagttaacgaatgcgatggataaaatcatgaaattaggc
atcgatatttctgataaaagtaatatcacaccgcaagatgtgcgagcgcaagcaatgagg
cattcagacaggcaacaagttatttttatagattatcttcaactgatggatactgatgcg
aaagttgatagacgtgtagcagtagaaaagatatcacgtgacttaaagataatcgctaac
gagacaggcgcaatcatcgtactactttcacaactgaatcgtggtgtcgagtctagacag
gataaaagaccaatgctatcggacatgaaagaatcaggcggaatagaagcagatgcgagt
ttagcgatgctactttaccgtgatgattattataaccgtgacgaagatgacagtatcact
ggcaaatctattgttgaatgtaacatagccaaaaacaaagacggcgaaaccggaataatt
gaatttgagtattacaagaagactcagaggtttttcacatga


  DNA with Flanking Sequence

>fig|93061.5.peg.1875 Phage DNA helicase (EC 3.6.4.12)
gcatggtggctatttaattaaagttttaaacaactgggctaaagagaatgtcaaaacaaa
agaagatgcagaaaataaaatagcacctagaaaaaatactactgatgatgtcattgcaca
aatggaaaaagaattgagtgatgactaatgccgatgagcaaaacacaagcattagaaatt
attaaaaaagttaggtacgtatacaacattgattttgataaaccgaagttagaaatgtgg
attgatgtattaagtcaaaatggagattatcaaccaactgtaaaagcggtagatgtttat
atcaacagtaacaacccgtacccgcctaacttaccagcaatcatgcgtaaggaacctaaa
aaagtatctatcgagccagtagataacgaaaccgctacacaccaatggaaaatgcagaat
gaccccgaatatgtcagacaaagaaaaatagcgctagataagttcatgaataagttggca
gaatttgggggcgaaaacgaatgaattacggacaattcgaaattgaaagtacaataatcg
ctacgctacttaaacaaccggacgtattagaaaagataagagttaaagattacatgttta
cgaacgaaaagtttaaaacctttttcaattatgtaatggacgtcggaaagatagatcatc
aagaaatctatttaaaagcaactaaagataaagaatttttagatgcagatactataacta
aactttacaactccgatttcattggatatggcttctttgaacgttatcaacaagaattat
tggaaagttatcagctcaacaaagctaacgaattggtaactgagttcaaacaacaaccta
cgaaccaaaactttaacaacttgattgatgaactcaaggatttaaaaacaattactaaca
aaaaagaagatggaaccaagaagtttgttgaggagtttgtcgaagagttatacagcgata
gccctaagaagcaaattaagacgggttacaagctaatggattacaaaatagggggattag
aaccatcacaattaatcgtcatcgcagcgcgtccctcagtgggtaagacaggttttgcat
taaacatgatgctgaacatagcacaaaatggatacaaaacatctttctttagtctcgaaa
caaccggcacatcggtattgaaacgtatgttatcaacaattactggtattgagttaacaa
agataaaagaaatcaggaacttaacgccggatgacttaacaaagttaacgaatgcgatgg
ataaaatcatgaaattaggcatcgatatttctgataaaagtaatatcacaccgcaagatg
tgcgagcgcaagcaatgaggcattcagacaggcaacaagttatttttatagattatcttc
aactgatggatactgatgcgaaagttgatagacgtgtagcagtagaaaagatatcacgtg
acttaaagataatcgctaacgagacaggcgcaatcatcgtactactttcacaactgaatc
gtggtgtcgagtctagacaggataaaagaccaatgctatcggacatgaaagaatcaggcg
gaatagaagcagatgcgagtttagcgatgctactttaccgtgatgattattataaccgtg
acgaagatgacagtatcactggcaaatctattgttgaatgtaacatagccaaaaacaaag
acggcgaaaccggaataattgaatttgagtattacaagaagactcagaggtttttcacat
gaatataatgcaattcaaaagcttattgaaatcgatgtatgaagagacaaagcaaagcga
cccgattgtagcaaatgtatatatcgagactggttgggcggtcaatagattgttggacaa
taacgagttatcgcctttcgatgattacgacagagttgaaaagaaaatcatgaatgaaat
caactggaagaaaacacacattaaggagtgttaaaaaatgccgaaagaaaaatattactt
ataccgagaagatggcacggaagatattaaggtcatcaagtataaagacaacgtaaatga
agtttattcgctcacaggagcccatttcagcgacgaaaagaaaattatgactgatagtga
cctaaaacgattcaaaggcgctcacgggcttctatatgagcaagagctaggattgcaagc
aacgatatttgatatttagaggtggcacaatgagtaaatacaatgctaagaaagttgagt
acaaaggaattgtatttgatag


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003678       F:DNA helicase activity
GO:0005524       F:ATP binding
GO:0006260       P:DNA replication
cmr|NT05SA1870 Staphylococcus aureus NCTC 8325     helicase DnaB
fig|12360.1.peg.16 Staphylococcus aureus phage phi 11 FIG   Phage DNA helicase (EC 3.6.4.12)
fig|93061.3.peg.1952 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Phage DNA helicase (EC 3.6.4.12)
gb|AAL82244.1 Staphylococcus aureus phage phi 11     helicase DnaB
gb|ABD31119.1 Staphylococcus aureus subsp. aureus NCTC 8325     bacteriophage L54a, DnaB-like helicase family protein
gi|18920503 Staphylococcus aureus phage phi 11 NCBI   helicase DnaB
gi|29028579 Staphylococcus phage 11 NCBI   helicase DnaB
gi|87203309 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   bacteriophage L54a, DnaB-like helicase family protein
gi|88195751 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   bacteriophage L54a, DnaB-like helicase family protein
img|637894694 Staphylococcus aureus aureus NCTC 8325 IMG   bacteriophage L54a, DnaB-like helicase family protein
img|638297011 Staphylococcus phage 11 IMG   helicase DnaB
kegg|sao:SAOUHSC_02067 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   bacteriophage L54a, DnaB-like helicase family protein
ref|NP_803269.1 Staphylococcus phage 11 RefSeq   helicase DnaB
ref|YP_500560.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   bacteriophage L54a, DnaB-like helicase family protein
tr|Q2FUP7 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Bacteriophage L54a, DnaB-like helicase family protein
tr|Q8SDW1 Staphylococcus phage phi11 (Bacteriophage phi-11) TrEMBL   Helicase DnaB


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search