The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93061.5.peg.1873: Staphylococcus aureus subsp. aureus NCTC 8325

This feature in The SEED Viewer

NCBI Taxonomy Id: 93061

Current Assignment: Phage phi 11 orf17 protein homolog
Translate Function Assignments



Context on contig NC_007795 from base 1948782 to 1959983 (11202 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1857 1950059 1948782 1278 -           Phage terminase, large subunit locus|SAOUHSC_02049, protein_id|YP_500542.1, gi|88195733, geneID|3920499
1858 1950486 1950046 441 - -14         Phage terminase, small subunit locus|SAOUHSC_02050, protein_id|YP_500543.1, gi|88195734, geneID|3920500
1859 1951095 1950673 423 - 186         Phage integrase regulator RinA locus|SAOUHSC_02051, protein_id|YP_500544.1, gi|88195735, geneID|3920501
1860 1951265 1951119 147 - 23         Phage protein ORF120 locus|SAOUHSC_02052, protein_id|YP_500545.1, gi|88195736, geneID|3920502
1861 1951439 1951266 174 - 0         Transcriptional activator rinB, phage associated locus|SAOUHSC_02053, protein_id|YP_500546.1, gi|88195737, geneID|3919740
1862 1951642 1951442 201 - 2         hypothetical protein locus|SAOUHSC_02054, protein_id|YP_500547.1, gi|88195738, geneID|3919741
1863 1951805 1951617 189 - -26         Phage phi 11 orf26a protein homolog locus|SAOUHSC_02055, protein_id|YP_500548.1, gi|88195739, geneID|3919742
1864 1952047 1951802 246 - -4         Hypothetical protein, SLT orf81b homolog [SA bacteriophages 11, Mu50B] locus|SAOUHSC_02056, protein_id|YP_500549.1, gi|88195740, geneID|3919743
1865 1952593 1952084 510 - 36         Phage deoxyuridine 5'-triphosphate nucleotidohydrolase (EC 3.6.1.23) locus|SAOUHSC_02057, protein_id|YP_500550.1, gi|88195741, geneID|3919744
1866 1952828 1952586 243 - -8         Phage protein locus|SAOUHSC_02058, protein_id|YP_500551.1, gi|88195742, geneID|3919745
1867 1953073 1952825 249 - -4         hypothetical protein locus|SAOUHSC_02059, protein_id|YP_500552.1, gi|88195743, geneID|3919746
1868 1953333 1953085 249 - 11         Phage phi 11 orf22 protein homolog locus|SAOUHSC_02060, protein_id|YP_500553.1, gi|88195744, geneID|3919747
1869 1953693 1953334 360 - 0         Phage phi 11 orf21 protein homolog locus|SAOUHSC_02061, protein_id|YP_500554.1, gi|88195745, geneID|3919748
1870 1953963 1953694 270 - 0         Phage transcriptional regulator cro locus|SAOUHSC_02062, protein_id|YP_500555.1, gi|88195746, geneID|3919749
1871 1954149 1953964 186 - 0         Phage phi 11 orf19 protein homolog locus|SAOUHSC_02063, protein_id|YP_500556.1, gi|88195747, geneID|3919750
1872 1954558 1954154 405 - 4         Phage phi 11 orf18 protein homolog locus|SAOUHSC_02064, protein_id|YP_500557.1, gi|88195748, geneID|3919751
1873 1954790 1954569 222 - 10         Phage phi 11 orf17 protein homolog locus|SAOUHSC_02065, protein_id|YP_500558.1, gi|88195749, geneID|3919752
1874 1954973 1954794 180 - 3         Phage protein locus|SAOUHSC_02066, protein_id|YP_500559.1, gi|88195750, geneID|3919753
1875 1956247 1955006 1242 - 32         Phage DNA helicase (EC 3.6.4.12) locus|SAOUHSC_02067, protein_id|YP_500560.1, gi|88195751, geneID|3919754
1876 1956600 1956244 357 - -4         Hypothetical protein, SAB1742c homolog [SA bacteriophages 11, Mu50B] locus|SAOUHSC_02068, protein_id|YP_500561.1, gi|88195752, geneID|3919755
1877 1957406 1956600 807 - -1         Phage replication initiation protein locus|SAOUHSC_02069, protein_id|YP_500562.1, gi|88195753, geneID|3919756
1878 1958070 1957378 693 - -29         Phage phi 11 orf14 protein homolog locus|SAOUHSC_02070, protein_id|YP_500563.1, gi|88195754, geneID|3919757
1879 1958637 1958083 555 - 12         Phage ssDNA binding protein locus|SAOUHSC_02071, protein_id|YP_500564.1, gi|88195755, geneID|3919758
1880 1959446 1958667 780 - 29         Phage phi 11 orf12 protein homolog locus|SAOUHSC_02072, protein_id|YP_500565.1, gi|88195756, geneID|3919759
1881 1959983 1959447 537 - 0         Phage phi 11 orf61 protein homolog locus|SAOUHSC_02073, protein_id|YP_500566.1, gi|88195757, geneID|3919760

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93061.5.peg.1873 Phage phi 11 orf17 protein homolog
MPKEKYYLYREDGTEDIKVIKYKDNVNEVYSLTGAHFSDEKKIMTDSDLKRFKGAHGLLY
EQELGLQATIFDI

MD5 = 384e27a8d6eef118975e60982929395c


  DNA Sequence

>fig|93061.5.peg.1873 Phage phi 11 orf17 protein homolog
atgccgaaagaaaaatattacttataccgagaagatggcacggaagatattaaggtcatc
aagtataaagacaacgtaaatgaagtttattcgctcacaggagcccatttcagcgacgaa
aagaaaattatgactgatagtgacctaaaacgattcaaaggcgctcacgggcttctatat
gagcaagagctaggattgcaagcaacgatatttgatatttag


  DNA with Flanking Sequence

>fig|93061.5.peg.1873 Phage phi 11 orf17 protein homolog
aacgagacaggcgcaatcatcgtactactttcacaactgaatcgtggtgtcgagtctaga
caggataaaagaccaatgctatcggacatgaaagaatcaggcggaatagaagcagatgcg
agtttagcgatgctactttaccgtgatgattattataaccgtgacgaagatgacagtatc
actggcaaatctattgttgaatgtaacatagccaaaaacaaagacggcgaaaccggaata
attgaatttgagtattacaagaagactcagaggtttttcacatgaatataatgcaattca
aaagcttattgaaatcgatgtatgaagagacaaagcaaagcgacccgattgtagcaaatg
tatatatcgagactggttgggcggtcaatagattgttggacaataacgagttatcgcctt
tcgatgattacgacagagttgaaaagaaaatcatgaatgaaatcaactggaagaaaacac
acattaaggagtgttaaaaaatgccgaaagaaaaatattacttataccgagaagatggca
cggaagatattaaggtcatcaagtataaagacaacgtaaatgaagtttattcgctcacag
gagcccatttcagcgacgaaaagaaaattatgactgatagtgacctaaaacgattcaaag
gcgctcacgggcttctatatgagcaagagctaggattgcaagcaacgatatttgatattt
agaggtggcacaatgagtaaatacaatgctaagaaagttgagtacaaaggaattgtattt
gatagcaaagtagagtgcgaatattaccaatatttagaaagtaatatgaatggcactaac
tatgatcgtatcgaaatacaaccgaaatttgaattacaacctaaattcgggaaacaaaga
ccgattacgtatatagccgatttctctttgtggaaggaagggaaactggttgaagttata
gacgttaaaggtaaggcgactgaagttgccaacatcaaagcgaagatattcagatatcag
tatagagatgtgaatttaacgtggatatgtaaagcgcctaaatacacaggtcaagaatgg
atggtatatgaggacttagtgaaagtcagacgtaaaagaaaaagagaaatgaagtgatct
aatgcaacaacaagcatatataaacgcaacgattgatataagaatacctacagaagttga
atatcagcattacgatgatgtg


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT05SA1868 Staphylococcus aureus NCTC 8325     conserved hypothetical protein
cmr|SACOL0345 Staphylococcus aureus subsp. aureus COL     hypothetical protein
dbj|BAA97610.1 Staphylococcus phage phiETA     unnamed protein product
fig|106284.1.peg.24 Bacteriophage phi ETA FIG   Phage phi 11 orf17 protein homolog
fig|12360.1.peg.17 Staphylococcus aureus phage phi 11 FIG   Phage phi 11 orf17 protein homolog
fig|259901.1.peg.46 Bacteriophage 77 FIG   Phage phi 11 orf17 protein homolog
fig|320834.3.peg.59 Bacteriophage 69 FIG   Phage phi 11 orf17 protein homolog
fig|320837.3.peg.59 Bacteriophage 42e FIG   Phage phi 11 orf17 protein homolog
fig|320842.3.peg.30 Bacteriophage 96 FIG   Phage phi 11 orf17 protein homolog
fig|320846.3.peg.63 Bacteriophage 29 FIG   Phage phi 11 orf17 protein homolog
fig|320847.3.peg.36 Bacteriophage 52A FIG   Phage phi 11 orf17 protein homolog
fig|548470.3.peg.1894 Staphylococcus aureus subsp. aureus MN8 FIG   Phage phi 11 orf17 protein homolog
fig|553571.3.peg.2313 Staphylococcus aureus A6300 FIG   Phage phi 11 orf17 protein homolog
fig|585151.3.peg.1541 Staphylococcus aureus subsp. aureus C427 FIG   Phage phi 11 orf17 protein homolog
fig|585155.3.peg.2593 Staphylococcus aureus subsp. aureus H19 FIG   Phage phi 11 orf17 protein homolog
fig|668618.2.peg.24 Staphylococcus phage P954 FIG   Phage phi 11 orf17 protein homolog
fig|681288.4.peg.843 Staphylococcus aureus subsp. aureus ED98 FIG   Phage phi 11 orf17 protein homolog
fig|93061.3.peg.1950 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Phage phi 11 orf17 protein homolog
fig|93062.4.peg.804 Staphylococcus aureus subsp. aureus COL FIG   Phage phi 11 orf17 protein homolog
gb|AAL82245.1 Staphylococcus aureus phage phi 11     phi ETA orf 24-like protein
gb|AAR87921.1 Bacteriophage 77     77ORF059
gb|AAW37552.1 Staphylococcus aureus subsp. aureus COL     hypothetical protein SACOL0345
gb|AAX90806.1 Bacteriophage 69     ORF064
gb|AAX91172.1 Bacteriophage 42e     ORF073
gb|AAX91476.1 Bacteriophage 96     ORF073
gb|AAX91773.1 Bacteriophage 29     ORF065
gb|AAX91844.1 Bacteriophage 52A     ORF068
gb|ABD31117.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical phage protein
gb|ACV04965.1 Staphylococcus phage P954     hypothetical protein
gb|EEI95864.1 Staphylococcus aureus subsp. aureus MN8     conserved hypothetical protein
gb|EEV76884.1 Staphylococcus aureus A6300     conserved hypothetical protein
gi|17426252 Staphylococcus phage phiETA NCBI   hypothetical protein phiETA_24
gi|18920504 Staphylococcus aureus phage phi 11 NCBI   phi ETA orf 24-like protein
gi|227246105 Staphylococcus aureus subsp. aureus MN8 NCBI   conserved hypothetical protein
gi|227557498 Staphylococcus aureus subsp. aureus MN8 NCBI   conserved hypothetical protein
gi|256681222 Staphylococcus phage P954 NCBI   hypothetical protein
gi|257136380 Staphylococcus phage P954 NCBI   hypothetical protein
gi|257853929 Staphylococcus aureus A6300 NCBI   conserved hypothetical protein
gi|258447270 Staphylococcus aureus A6300 NCBI   conserved hypothetical protein
gi|29028580 Staphylococcus phage 11 NCBI   phi ETA orf 24-like protein
gi|40557265 Bacteriophage 77 NCBI   77ORF059
gi|41189564 Staphylococcus phage 77 NCBI   77ORF059
gi|57285458 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL0345
gi|57651272 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL0345
gi|62635695 Bacteriophage 69 NCBI   ORF064
gi|62636061 Bacteriophage 42e NCBI   ORF073
gi|62636365 Bacteriophage 96 NCBI   ORF073
gi|62636662 Bacteriophage 29 NCBI   ORF065
gi|62636733 Bacteriophage 52A NCBI   ORF068
gi|66395344 Staphylococcus phage 69 NCBI   ORF064
gi|66395568 Staphylococcus phage 42E NCBI   ORF073
gi|66395944 Staphylococcus phage 96 NCBI   ORF073
gi|66396245 Staphylococcus phage 29 NCBI   ORF065
gi|66396317 Staphylococcus phage 52A NCBI   ORF068
gi|87203307 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical phage protein
gi|88195749 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_02065
gi|8918439 Staphylococcus phage phiETA NCBI   unnamed protein product
img|637151120 Staphylococcus aureus aureus COL IMG   hypothetical protein
img|637894692 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|638290211 Bacteriophage phi ETA IMG   hypothetical protein
img|638297012 Staphylococcus phage 11 IMG   phi ETA orf 24-like protein
img|638305524 Bacteriophage 77 IMG   77ORF059
img|638314042 Bacteriophage 69 IMG   ORF064
img|638314331 Bacteriophage 42e IMG   ORF073
img|638314701 Bacteriophage 96 IMG   ORF073
img|638315010 Bacteriophage 29 IMG   ORF065
img|638315076 Bacteriophage 52A IMG   ORF068
kegg|sac:SACOL0345 Staphylococcus aureus subsp. aureus COL KEGG   hypothetical protein
kegg|sao:SAOUHSC_02065 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
ref|NP_510918.1 Staphylococcus phage phiETA RefSeq   hypothetical protein phiETA_24
ref|NP_803270.1 Staphylococcus phage 11 RefSeq   phi ETA orf 24-like protein
ref|NP_958647.1 Staphylococcus phage 77 RefSeq   77ORF059
ref|YP_003169654.1 Staphylococcus phage P954 RefSeq   hypothetical protein
ref|YP_185237.1 Staphylococcus aureus subsp. aureus COL RefSeq   hypothetical protein SACOL0345
ref|YP_239623.1 Staphylococcus phage 69 RefSeq   ORF064
ref|YP_239912.1 Staphylococcus phage 42E RefSeq   ORF073
ref|YP_240282.1 Staphylococcus phage 96 RefSeq   ORF073
ref|YP_240591.1 Staphylococcus phage 29 RefSeq   ORF065
ref|YP_240657.1 Staphylococcus phage 52A RefSeq   ORF068
ref|YP_500558.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_02065
ref|ZP_03987545.1 Staphylococcus aureus subsp. aureus MN8 RefSeq   conserved hypothetical protein
ref|ZP_05695418.1 Staphylococcus aureus A6300 RefSeq   conserved hypothetical protein
tr|C2K605 Staphylococcus aureus subsp. aureus MN8 TrEMBL   Putative uncharacterized protein
tr|Q2FX35 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Conserved hypothetical phage protein
tr|Q4ZAR9 Staphylococcus phage 52A TrEMBL   ORF068
tr|Q4ZAY5 Staphylococcus phage 29 TrEMBL   ORF065
tr|Q4ZBU4 Staphylococcus phage 96 TrEMBL   ORF073
tr|Q4ZCW4 Staphylococcus phage 42E TrEMBL   ORF073
tr|Q4ZDQ3 Staphylococcus phage 69 TrEMBL   ORF064
tr|Q5HJ20 Staphylococcus aureus (strain COL) TrEMBL   Putative uncharacterized protein
tr|Q6R836 Staphylococcus phage 77 TrEMBL   77ORF059
tr|Q776M5 Staphylococcus phage phiETA TrEMBL   ORF24
tr|Q9G021 Staphylococcus phage phi11 (Bacteriophage phi-11) TrEMBL   Phi ETA orf 24-like protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


Tool Description
General Tools
Psi-Blast NCBI's psi-blast is used to locate distant similarities
Transmembrane Predictions
TMpred Tool for Predicting Transmembrane regions
TMHMM Prediction of transmembrane helices in proteins
Protein Signals for Gram negative bacteria
Gram negative PSORT Prediction of protein localization sites
Gram negative SignalP Predicts the presence and location of signal peptide cleavage sites
Protein Signals for Gram positive bacteria
Gram positive PSORT Prediction of protein localization sites
Gram positive SignalP Predicts the presence and location of signal peptide cleavage sites
Other useful tools
LipoP Prediction of lipoproteins and signal peptides in Gram negative bacteria
Radar Rapid Automatic Detection and Alignment of Repeats in protein sequences
PPSearch Search for protein motifs against all patterns stored in the PROSITE pattern database
Gram negative CELLO Subcellular localization predictor at National Chiao Tung University
Gram positive CELLO Subcellular localization predictor at National Chiao Tung University
ProDom A comprehensive set of protein domain families automatically generated from the SWISS-PROT and TrEMBL sequence databases
PDB An Information Portal to Biological Macromolecular Structures
For Specific Organisms
RNAFold The RNAfold web server will predict secondary structures of single stranded RNA or DNA sequences.

< Hide tool descriptions


FIG search