The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93061.5.peg.1872: Staphylococcus aureus subsp. aureus NCTC 8325

This feature in The SEED Viewer

NCBI Taxonomy Id: 93061

Current Assignment: Phage phi 11 orf18 protein homolog
Translate Function Assignments



Context on contig NC_007795 from base 1948782 to 1959983 (11202 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1857 1950059 1948782 1278 -           Phage terminase, large subunit locus|SAOUHSC_02049, protein_id|YP_500542.1, gi|88195733, geneID|3920499
1858 1950486 1950046 441 - -14         Phage terminase, small subunit locus|SAOUHSC_02050, protein_id|YP_500543.1, gi|88195734, geneID|3920500
1859 1951095 1950673 423 - 186         Phage integrase regulator RinA locus|SAOUHSC_02051, protein_id|YP_500544.1, gi|88195735, geneID|3920501
1860 1951265 1951119 147 - 23         Phage protein ORF120 locus|SAOUHSC_02052, protein_id|YP_500545.1, gi|88195736, geneID|3920502
1861 1951439 1951266 174 - 0         Transcriptional activator rinB, phage associated locus|SAOUHSC_02053, protein_id|YP_500546.1, gi|88195737, geneID|3919740
1862 1951642 1951442 201 - 2         hypothetical protein locus|SAOUHSC_02054, protein_id|YP_500547.1, gi|88195738, geneID|3919741
1863 1951805 1951617 189 - -26         Phage phi 11 orf26a protein homolog locus|SAOUHSC_02055, protein_id|YP_500548.1, gi|88195739, geneID|3919742
1864 1952047 1951802 246 - -4         Hypothetical protein, SLT orf81b homolog [SA bacteriophages 11, Mu50B] locus|SAOUHSC_02056, protein_id|YP_500549.1, gi|88195740, geneID|3919743
1865 1952593 1952084 510 - 36         Phage deoxyuridine 5'-triphosphate nucleotidohydrolase (EC 3.6.1.23) locus|SAOUHSC_02057, protein_id|YP_500550.1, gi|88195741, geneID|3919744
1866 1952828 1952586 243 - -8         Phage protein locus|SAOUHSC_02058, protein_id|YP_500551.1, gi|88195742, geneID|3919745
1867 1953073 1952825 249 - -4         hypothetical protein locus|SAOUHSC_02059, protein_id|YP_500552.1, gi|88195743, geneID|3919746
1868 1953333 1953085 249 - 11         Phage phi 11 orf22 protein homolog locus|SAOUHSC_02060, protein_id|YP_500553.1, gi|88195744, geneID|3919747
1869 1953693 1953334 360 - 0         Phage phi 11 orf21 protein homolog locus|SAOUHSC_02061, protein_id|YP_500554.1, gi|88195745, geneID|3919748
1870 1953963 1953694 270 - 0         Phage transcriptional regulator cro locus|SAOUHSC_02062, protein_id|YP_500555.1, gi|88195746, geneID|3919749
1871 1954149 1953964 186 - 0         Phage phi 11 orf19 protein homolog locus|SAOUHSC_02063, protein_id|YP_500556.1, gi|88195747, geneID|3919750
1872 1954558 1954154 405 - 4         Phage phi 11 orf18 protein homolog locus|SAOUHSC_02064, protein_id|YP_500557.1, gi|88195748, geneID|3919751
1873 1954790 1954569 222 - 10         Phage phi 11 orf17 protein homolog locus|SAOUHSC_02065, protein_id|YP_500558.1, gi|88195749, geneID|3919752
1874 1954973 1954794 180 - 3         Phage protein locus|SAOUHSC_02066, protein_id|YP_500559.1, gi|88195750, geneID|3919753
1875 1956247 1955006 1242 - 32         Phage DNA helicase (EC 3.6.4.12) locus|SAOUHSC_02067, protein_id|YP_500560.1, gi|88195751, geneID|3919754
1876 1956600 1956244 357 - -4         Hypothetical protein, SAB1742c homolog [SA bacteriophages 11, Mu50B] locus|SAOUHSC_02068, protein_id|YP_500561.1, gi|88195752, geneID|3919755
1877 1957406 1956600 807 - -1         Phage replication initiation protein locus|SAOUHSC_02069, protein_id|YP_500562.1, gi|88195753, geneID|3919756
1878 1958070 1957378 693 - -29         Phage phi 11 orf14 protein homolog locus|SAOUHSC_02070, protein_id|YP_500563.1, gi|88195754, geneID|3919757
1879 1958637 1958083 555 - 12         Phage ssDNA binding protein locus|SAOUHSC_02071, protein_id|YP_500564.1, gi|88195755, geneID|3919758
1880 1959446 1958667 780 - 29         Phage phi 11 orf12 protein homolog locus|SAOUHSC_02072, protein_id|YP_500565.1, gi|88195756, geneID|3919759
1881 1959983 1959447 537 - 0         Phage phi 11 orf61 protein homolog locus|SAOUHSC_02073, protein_id|YP_500566.1, gi|88195757, geneID|3919760

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93061.5.peg.1872 Phage phi 11 orf18 protein homolog
MSKYNAKKVEYKGIVFDSKVECEYYQYLESNMNGTNYDRIEIQPKFELQPKFGKQRPITY
IADFSLWKEGKLVEVIDVKGKATEVANIKAKIFRYQYRDVNLTWICKAPKYTGQEWMVYE
DLVKVRRKRKREMK

MD5 = 3a2c814e44ea5b985d19b5eeb311e7a6


  DNA Sequence

>fig|93061.5.peg.1872 Phage phi 11 orf18 protein homolog
atgagtaaatacaatgctaagaaagttgagtacaaaggaattgtatttgatagcaaagta
gagtgcgaatattaccaatatttagaaagtaatatgaatggcactaactatgatcgtatc
gaaatacaaccgaaatttgaattacaacctaaattcgggaaacaaagaccgattacgtat
atagccgatttctctttgtggaaggaagggaaactggttgaagttatagacgttaaaggt
aaggcgactgaagttgccaacatcaaagcgaagatattcagatatcagtatagagatgtg
aatttaacgtggatatgtaaagcgcctaaatacacaggtcaagaatggatggtatatgag
gacttagtgaaagtcagacgtaaaagaaaaagagaaatgaagtga


  DNA with Flanking Sequence

>fig|93061.5.peg.1872 Phage phi 11 orf18 protein homolog
ccggaataattgaatttgagtattacaagaagactcagaggtttttcacatgaatataat
gcaattcaaaagcttattgaaatcgatgtatgaagagacaaagcaaagcgacccgattgt
agcaaatgtatatatcgagactggttgggcggtcaatagattgttggacaataacgagtt
atcgcctttcgatgattacgacagagttgaaaagaaaatcatgaatgaaatcaactggaa
gaaaacacacattaaggagtgttaaaaaatgccgaaagaaaaatattacttataccgaga
agatggcacggaagatattaaggtcatcaagtataaagacaacgtaaatgaagtttattc
gctcacaggagcccatttcagcgacgaaaagaaaattatgactgatagtgacctaaaacg
attcaaaggcgctcacgggcttctatatgagcaagagctaggattgcaagcaacgatatt
tgatatttagaggtggcacaatgagtaaatacaatgctaagaaagttgagtacaaaggaa
ttgtatttgatagcaaagtagagtgcgaatattaccaatatttagaaagtaatatgaatg
gcactaactatgatcgtatcgaaatacaaccgaaatttgaattacaacctaaattcggga
aacaaagaccgattacgtatatagccgatttctctttgtggaaggaagggaaactggttg
aagttatagacgttaaaggtaaggcgactgaagttgccaacatcaaagcgaagatattca
gatatcagtatagagatgtgaatttaacgtggatatgtaaagcgcctaaatacacaggtc
aagaatggatggtatatgaggacttagtgaaagtcagacgtaaaagaaaaagagaaatga
agtgatctaatgcaacaacaagcatatataaacgcaacgattgatataagaatacctaca
gaagttgaatatcagcattacgatgatgtggataaagaaaaagatacgctggcaaagcgc
ttagatgacaatccggacgaattactaaagtatgacaacataacaataagacatgcatat
atagaggtggaataaatgaagttgaacgaagtattcgcaactaatttaagggtaatcatg
gctagagataacgtaagtgtccaagatttgcacaatgaaactggcgtatcaagatcaact
attagtggatataaaaacggaaaagctgagatggttaacttaaatgtattagataaattg
gcagatgctctaggtgttaatgtaagtgaactatttactagaaatcacaacacgcacaaa
ttagaggattggattaaaaaaagtaaatgtatagaggtggaataaatgagtatcgtaaag
attaacggtaaaccatataaattta


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT05SA1867 Staphylococcus aureus NCTC 8325     77ORF028
cmr|NT11SA1758 Staphylococcus aureus RF122     77ORF028
emb|CAI81427.1 Staphylococcus aureus RF122 EMBL   hypothetical phage-related protein
fig|12360.1.peg.18 Staphylococcus aureus phage phi 11 FIG   Phage phi 11 orf18 protein homolog
fig|273036.3.peg.1679 Staphylococcus aureus RF122 FIG   Phage phi 11 orf18 protein homolog
fig|273036.6.peg.1844 Staphylococcus aureus RF122 FIG   Phage phi 11 orf18 protein homolog
fig|320837.3.peg.60 Bacteriophage 42e FIG   Phage phi 11 orf18 protein homolog
fig|320842.3.peg.31 Bacteriophage 96 FIG   Phage phi 11 orf18 protein homolog
fig|553571.3.peg.2312 Staphylococcus aureus A6300 FIG   Phage phi 11 orf18 protein homolog
fig|575608.2.peg.21 Siphoviridae Staphylococcus phage phiSauS-IPLA88 FIG   Phage phi 11 orf18 protein homolog
fig|585151.3.peg.1540 Staphylococcus aureus subsp. aureus C427 FIG   Phage phi 11 orf18 protein homolog
fig|93061.3.peg.1949 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Phage phi 11 orf18 protein homolog
gb|AAL82246.1 Staphylococcus aureus phage phi 11     phi ETA orf 25-like protein
gb|AAX91145.1 Bacteriophage 42e     ORF033
gb|AAX91449.1 Bacteriophage 96     ORF032
gb|ABD31116.1 Staphylococcus aureus subsp. aureus NCTC 8325     phi ETA orf 25-like protein
gb|ACJ64550.1 Staphylococcus phage phiSauS-IPLA88     gp22
gb|EEV76883.1 Staphylococcus aureus A6300     gp22
gi|18920505 Staphylococcus aureus phage phi 11 NCBI   phi ETA orf 25-like protein
gi|215260419 Staphylococcus phage phiSauS-IPLA88 NCBI   gp22
gi|215401192 Staphylococcus phage phiSauS-IPLA88 NCBI   hypothetical protein SauSIPLA88_gp22
gi|257853928 Staphylococcus aureus A6300 NCBI   gp22
gi|258447269 Staphylococcus aureus A6300 NCBI   gp22
gi|29028581 Staphylococcus phage 11 NCBI   phi ETA orf 25-like protein
gi|62636034 Bacteriophage 42e NCBI   ORF033
gi|62636338 Bacteriophage 96 NCBI   ORF032
gi|66395541 Staphylococcus phage 42E NCBI   ORF033
gi|66395917 Staphylococcus phage 96 NCBI   ORF032
gi|82656990 Staphylococcus aureus RF122 NCBI   hypothetical phage-related protein
gi|82751459 Staphylococcus aureus RF122 NCBI   phage-like protein
gi|87203306 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   phi ETA orf 25-like protein
gi|88195748 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   phi ETA orf 25-like protein
img|637816671 Staphylococcus aureus RF122 IMG   hypothetical phage-related protein
img|637894691 Staphylococcus aureus aureus NCTC 8325 IMG   phi ETA orf 25-like protein
img|638297013 Staphylococcus phage 11 IMG   phi ETA orf 25-like protein
img|638314332 Bacteriophage 42e IMG   ORF033
img|638314702 Bacteriophage 96 IMG   ORF032
kegg|sab:SAB1738c Staphylococcus aureus RF122 KEGG   phage-like protein
kegg|sao:SAOUHSC_02064 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   phi ETA orf 25-like protein
ref|NP_803271.1 Staphylococcus phage 11 RefSeq   phi ETA orf 25-like protein
ref|YP_002332497.1 Staphylococcus phage phiSauS-IPLA88 RefSeq   hypothetical protein SauSIPLA88_gp22
ref|YP_239913.1 Staphylococcus phage 42E RefSeq   ORF033
ref|YP_240283.1 Staphylococcus phage 96 RefSeq   ORF032
ref|YP_417200.1 Staphylococcus aureus RF122 RefSeq   phage-like protein
ref|YP_500557.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   phi ETA orf 25-like protein
ref|ZP_05695417.1 Staphylococcus aureus A6300 RefSeq   gp22
tr|B7T0B2 Staphylococcus phage phiSauS-IPLA88 TrEMBL   Gp22
tr|Q2FX36 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Phi ETA orf 25-like protein
tr|Q2YTU9 Staphylococcus aureus (strain bovine RF122 / ET3-1) TrEMBL   Hypothetical phage-related protein
tr|Q4ZBU3 Staphylococcus phage 96 TrEMBL   ORF032
tr|Q4ZCW3 Staphylococcus phage 42E TrEMBL   ORF033
tr|Q8SDW0 Staphylococcus phage phi11 (Bacteriophage phi-11) TrEMBL   Phi ETA orf 25-like protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search