The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93061.3.peg.1958: Staphylococcus aureus subsp. aureus NCTC 8325

This feature in The SEED Viewer

NCBI Taxonomy Id: 93061

Current Assignment: Phage phi 11 orf61 protein homolog
Translate Function Assignments



Context on contig NC_007795 from base 1918534 to 1967285 (48752 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
pp.2 1918534 1967285 48752 +           Prophage 2. Evidence: 15 nt repeat confirmed by Ramy; attL: fig|93061.3.att.3; attR: fig|93061.3.att.4  
1949 1954558 1954154 405 - -13132     1: 1 ff
isu
Phage phi 11 orf18 protein homolog cds.1949, GeneID:3919751, LocusTag:SAOUHSC_02064, YP_500557.1, gi|88195748
1950 1954790 1954569 222 - 10     1: 1 ff
isu
Phage phi 11 orf17 protein homolog cds.1950, GeneID:3919752, LocusTag:SAOUHSC_02065, YP_500558.1, gi|88195749
1951 1955009 1954794 216 - 3       ff Phage protein cds.1951, GeneID:3919753, LocusTag:SAOUHSC_02066, YP_500559.1, gi|88195750
1952 1956247 1955006 1242 - -4     1: 1 ff
isu
Phage DNA helicase (EC 3.6.4.12) cds.1952, GeneID:3919754, LocusTag:SAOUHSC_02067, YP_500560.1, gi|88195751
1953 1956600 1956244 357 - -4     1: 1 isu Hypothetical protein, SAB1742c homolog [SA bacteriophages 11, Mu50B] cds.1953, GeneID:3919755, LocusTag:SAOUHSC_02068, YP_500561.1, gi|88195752
1954 1957406 1956600 807 - -1     1: 1 ff
isu
Phage replication initiation protein cds.1954, GeneID:3919756, LocusTag:SAOUHSC_02069, YP_500562.1, gi|88195753
1955 1958070 1957378 693 - -29     1: 1 ff
isu
Phage phi 11 orf14 protein homolog cds.1955, GeneID:3919757, LocusTag:SAOUHSC_02070, YP_500563.1, gi|88195754
1956 1958583 1958083 501 - 12     1: 1 ff
isu
Single stranded DNA binding protein, phage-associated cds.1956, GeneID:3919758, LocusTag:SAOUHSC_02071, YP_500564.1, gi|88195755
1957 1959446 1958667 780 - 83     1: 1 isu Phage phi 11 orf12 protein homolog cds.1957, GeneID:3919759, LocusTag:SAOUHSC_02072, YP_500565.1, gi|88195756
1958 1959983 1959447 537 - 0         Phage phi 11 orf61 protein homolog cds.1958, GeneID:3919760, LocusTag:SAOUHSC_02073, YP_500566.1, gi|88195757
1959 1960316 1959996 321 - 12     1: 1 ff
isu
Phage phi 11 orf11 protein homolog cds.1959, GeneID:3919761, LocusTag:SAOUHSC_02074, YP_500567.1, gi|88195758
1960 1960566 1960237 330 - -80       ff Phage protein cds.1960, GeneID:3919762, LocusTag:SAOUHSC_02075, YP_500568.1, gi|88195759
1961 1960817 1960656 162 - 89         Phage phi 11 orf10a protein homolog cds.1961, GeneID:3919763, LocusTag:SAOUHSC_02076, YP_500569.1, gi|88195760
1962 1961094 1960810 285 - -8     1: 1 ff
isu
Hypothetical protein, PV83 orf12 homolog [SA bacteriophages 11, Mu50B] cds.1962, GeneID:3919764, LocusTag:SAOUHSC_02077, YP_500570.1, gi|88195761
1963 1961494 1961045 450 - -50     1: 1 ff
isu
Phage phi 11 orf9 protein homolog cds.1963, GeneID:3919765, LocusTag:SAOUHSC_02078, YP_500571.1, gi|88195762
1964 1961760 1961536 225 - 41     1: 1 ff
isu
Phage phi 11 orf8 protein homolog cds.1964, GeneID:3919766, LocusTag:SAOUHSC_02079, YP_500572.1, gi|88195763
sRNA.6 1961967 1962165 199 + 206     1: 2   6S RNA (Pichon, Felden, 2005)  
1965 1962552 1961761 792 - -405     2: 1 3 ff
isu
Phage antirepressor protein cds.1965, GeneID:3919767, LocusTag:SAOUHSC_02080, YP_500573.1, gi|88195764
1966 1963017 1962709 309 - 156       ff Phage protein cds.1966, GeneID:3919768, LocusTag:SAOUHSC_02081, YP_500574.1, gi|88195765
1967 1963250 1963032 219 - 14     1: 1 ff
isu
Phage transcriptional regulator cro cds.1967, GeneID:3919769, LocusTag:SAOUHSC_02083, YP_500575.1, gi|88195766
1968 1963392 1964111 720 + 141     1: 1 ff
isu
Phage repressor protein cI cds.1968, GeneID:3919770, LocusTag:SAOUHSC_02084, YP_500576.1, gi|88195767
1969 1964181 1964348 168 + 69         Phage protein cds.1969, GeneID:3919771, LocusTag:SAOUHSC_02085, YP_500577.1, gi|88195768
1970 1964508 1964693 186 + 159     1: 1 isu Phage phi 11 orf4 protein homolog cds.1970, GeneID:3919772, LocusTag:SAOUHSC_02086, YP_500578.1, gi|88195769
1971 1964729 1965634 906 + 35     1: 1 isu Phage phi 11 orf3 protein homolog cds.1971, GeneID:3919773, LocusTag:SAOUHSC_02087, YP_500579.1, gi|88195770

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93061.3.peg.1958 Phage phi 11 orf61 protein homolog
MNDLQERELETFEQDDRFKVTDLDSANWVFKKLDAITTKENEINDLANKEIERINEWKDK
EVEKLQSGKEYLQSLVIEYYRIQKEQDSKFKLNTPYGKVTARKGSKVIQVSNEQEVIKQL
EQRGFDNYVKVTKKLSQSDIKKDFNVTENGTLIDANGEVLEGASIVEKPTSYTVKVGE

MD5 = c5dcd6db5a5b0b799ece14eaf6085449


  DNA Sequence

>fig|93061.3.peg.1958 Phage phi 11 orf61 protein homolog
gtgaatgatttacaagagagagaattagaaacattcgaacaagacgaccgattcaaagta
actgatctagacagtgctaactgggtttttaagaaactggatgcaatcacaactaaagag
aatgaaatcaacgatttagcaaataaagaaattgaacgcataaacgaatggaaagataaa
gaagtagaaaaattacagagtggcaaagaatatttacaaagccttgtaattgaatattac
agaatacaaaaagaacaagatagcaaattcaagttgaatacaccttacggaaaagtgaca
gccagaaaaggttcaaaagtcattcaagttagcaatgagcaagaagtcattaaacaactt
gagcaacgaggttttgacaactatgtaaaagtaactaaaaaacttagccaatcagacatt
aagaaagatttcaatgtaactgaaaacggcacattgattgacgcaaacggcgaagtttta
gagggtgctagcattgtggagaaaccaacgtcatacacggtaaaggtgggagaatag


  DNA with Flanking Sequence

>fig|93061.3.peg.1958 Phage phi 11 orf61 protein homolog
aaatcaagaattgacagtaacaatcacattgaacgagtacagaaaacttattgaaataaa
ggctgttaaagataaagaagaagatacttacagaggtaagtattttgcggaagaaagaaa
aaacgaaaaattggaaaaagaaaatataaaactaaaaaacaaaatttatgaattacaaaa
cgaagaagataacgaggaggacgaagaagacaaggaggacgagaacgatgtattacaaaa
ttggtgagataaaaaacaaaattataagctttaacgggtttgaatttaaagtgtctgtga
tgaagagacatgacggtatcagtatacaaatcaaggatatgaataatgttccacttaaat
cgtttcatgtcatagatttaagcgaactatatattgcgacggatgcaatgcgtgacgtta
taaacgaatggattgaaaataacacagatgaacaggacaaactaattaacttagtcatga
aatggtaggaggtatgaaaagtgaatgatttacaagagagagaattagaaacattcgaac
aagacgaccgattcaaagtaactgatctagacagtgctaactgggtttttaagaaactgg
atgcaatcacaactaaagagaatgaaatcaacgatttagcaaataaagaaattgaacgca
taaacgaatggaaagataaagaagtagaaaaattacagagtggcaaagaatatttacaaa
gccttgtaattgaatattacagaatacaaaaagaacaagatagcaaattcaagttgaata
caccttacggaaaagtgacagccagaaaaggttcaaaagtcattcaagttagcaatgagc
aagaagtcattaaacaacttgagcaacgaggttttgacaactatgtaaaagtaactaaaa
aacttagccaatcagacattaagaaagatttcaatgtaactgaaaacggcacattgattg
acgcaaacggcgaagttttagagggtgctagcattgtggagaaaccaacgtcatacacgg
taaaggtgggagaatagatgactgaaaaaactaatcaagatgtcgatattttaacgcaac
taggtgtaaaagacatcagcaaacaaaatgcaaacaagttttataaatttgcgatatacg
gcaagttcggtactggtaaaactacgtttttaacaaaagataacaatgccttagtactag
atataaatgaggacggaacaacggtaacagaagatggggcagttgtgcagattaagaatt
ataagcattttagtgcagtgattaaaatgctgcctaaaattattgaacaactaagagaaa
acggaaaacaaattgatgttgtagtgattgaaacaatccaaaagttacgtgatatcacta
tggacgacatcatggacggtaaatcaaagaaaccgacatttaatgattggggcgagtgtg
ctacacgcattgtaagtatttatcgttatatttctaaattacaagaacattatcaatttc
atcttgctataagcggacacgagggcattaacaaaga


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT05SA1876 Staphylococcus aureus NCTC 8325     conserved hypothetical protein
fig|320842.3.peg.22 Bacteriophage 96 FIG   Phage phi 11 orf61 protein homolog
fig|320847.3.peg.29 Bacteriophage 52A FIG   Phage phi 11 orf61 protein homolog
fig|405947.2.peg.12 Siphoviridae Staphylococcus phage 80 FIG   Phage phi 11 orf61 protein homolog
fig|680649.3.peg.2343 Staphylococcus aureus subsp. aureus MR1 FIG   Phage phi 11 orf61 protein homolog
fig|93061.5.peg.1881 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Phage phi 11 orf61 protein homolog
gb|AAX91439.1 Bacteriophage 96     ORF022
gb|AAX91817.1 Bacteriophage 52A     ORF023
gb|ABD31125.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical phage protein
gb|ABJ88860.1 Staphylococcus phage 80     conserved hypothetical protein
gi|116235525 Staphylococcus phage 80 NCBI   conserved hypothetical protein
gi|62636328 Bacteriophage 96 NCBI   ORF022
gi|62636706 Bacteriophage 52A NCBI   ORF023
gi|66395907 Staphylococcus phage 96 NCBI   ORF022
gi|66396290 Staphylococcus phage 52A NCBI   ORF023
gi|87203315 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical phage protein
gi|88195757 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_02073
img|637894700 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|638314693 Bacteriophage 96 IMG   ORF022
img|638315069 Bacteriophage 52A IMG   ORF023
kegg|sao:SAOUHSC_02073 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
ref|YP_240274.1 Staphylococcus phage 96 RefSeq   ORF022
ref|YP_240650.1 Staphylococcus phage 52A RefSeq   ORF023
ref|YP_500566.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_02073
tr|A7YGQ3 Staphylococcus phage 80 TrEMBL   Putative uncharacterized protein
tr|Q2FX32 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Conserved hypothetical phage protein
tr|Q4ZAS6 Staphylococcus phage 52A TrEMBL   ORF023
tr|Q4ZBV2 Staphylococcus phage 96 TrEMBL   ORF022


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value
isoelectric_point 4.72
molecular_weight 20647
PFAM::PF07211 895.600;17-176
PSORT::unknown unknown
similar_to_human no


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search