The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|904782.3.peg.2764: Staphylococcus aureus subsp. aureus IS-111

This feature in The SEED Viewer

NCBI Taxonomy Id: 904782

Current Assignment: L-Cystine ABC transporter, periplasmic cystine-binding protein TcyA
Translate Function Assignments



Context on contig AHLS01000145 from base 28 to 5603 (5576 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2764 28 807 780 +         L-Cystine ABC transporter, periplasmic cystine-binding protein TcyA locus|IS111_0242, protein_id|EHS24439.1, gi|375031150
2765 788 1507 720 + -20 25     amino acid ABC transporter, permease protein locus|IS111_0243, protein_id|EHS24423.1, gi|375031134
2766 1504 2235 732 + -4 16     L-cystine ABC transporter, ATP-binding protein TcyC locus|IS111_0244, protein_id|EHS24470.1, gi|375031181
2767 3582 2332 1251 - 96         FmhA protein of FemAB family gene_name|femA_1, locus|IS111_0245, protein_id|EHS24475.1, gi|375031186
2768 3837 4196 360 + 254         FIG01108076: hypothetical protein locus|IS111_0246, protein_id|EHS24479.1, gi|375031190
2769 4215 4814 600 + 18         Protein-disulfide isomerase, related to DsbA locus|IS111_0247, protein_id|EHS24432.1, gi|375031143
2770 5087 5338 252 + 272         YefM protein (antitoxin to YoeB) locus|IS111_0248, protein_id|EHS24443.1, gi|375031154
2771 5412 5603 192 + 73         FIG01108752: hypothetical protein locus|IS111_0249, protein_id|EHS24438.1, gi|375031149

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|904782.3.peg.2764 L-Cystine ABC transporter, periplasmic cystine-binding protein TcyA
MKRLLFVMIAFVFILAACGNNSSKDKEASKDSKTINVGTEGTYAPFSFHDKDGKLTGYDI
DVIKAVAKEEGLKLKFNETSWDSMFAGLDAGRFDVIANQVGINPDREKKYKFSKPYTFSS
AVLVIRENEKDIKDFDDVKGKKLAQTFTSNYGKLAKDKGADITKVDGFNQSMDLLLSKRV
DGTFNDSLSYLDYKKQKPNAKIKAIKGNAEQSRSAFAFSKKADDETVQKFNDGLKKIEEN
GELAKIGKKWFGQDVSKSK

MD5 = 666837dbe7c757f98a97dcf55c333bb5


  DNA Sequence

>fig|904782.3.peg.2764 L-Cystine ABC transporter, periplasmic cystine-binding protein TcyA
atgaaaagacttttatttgtgatgatagctttcgttttcatattggctgcatgcggaaac
aattcgtcgaaagacaaggaagctagtaaagatagcaagacaattaatgttgggactgag
gggacttatgcaccatttagtttccacgataaagatggtaaattaactggttacgatatt
gatgttattaaagcagtggctaaagaagaaggtttaaaacttaaatttaatgaaacttct
tgggattctatgtttgcaggtttagacgcagggcgttttgatgtaatcgcgaaccaagta
ggtattaatcctgatagagaaaagaaatataaattttctaagccttacacattctcaagt
gctgttttagttattcgtgaaaatgaaaaagatattaaagattttgatgatgttaaaggt
aagaagttagcacaaacattcacatctaattatggtaaattagctaaggataaaggtgct
gatattacaaaagttgatggctttaaccaatcaatggatttattattgtctaagcgtgtt
gatggtacatttaatgatagtctgtcatacttggattataaaaaacaaaaacctaatgct
aagatcaaagcaatcaaaggtaatgctgaacaaagtagatctgcatttgcattttctaaa
aaagcagatgatgaaacagttcaaaaattcaatgatggcttgaaaaaaatcgaggaaaac
ggtgaattagctaaaataggtaagaaatggtttggtcaagatgtttctaaatctaaatag


  DNA with Flanking Sequence

>fig|904782.3.peg.2764 L-Cystine ABC transporter, periplasmic cystine-binding protein TcyA
aataataagaataaggagatatattctatgaaaagacttttatttgtgatgatagctttc
gttttcatattggctgcatgcggaaacaattcgtcgaaagacaaggaagctagtaaagat
agcaagacaattaatgttgggactgaggggacttatgcaccatttagtttccacgataaa
gatggtaaattaactggttacgatattgatgttattaaagcagtggctaaagaagaaggt
ttaaaacttaaatttaatgaaacttcttgggattctatgtttgcaggtttagacgcaggg
cgttttgatgtaatcgcgaaccaagtaggtattaatcctgatagagaaaagaaatataaa
ttttctaagccttacacattctcaagtgctgttttagttattcgtgaaaatgaaaaagat
attaaagattttgatgatgttaaaggtaagaagttagcacaaacattcacatctaattat
ggtaaattagctaaggataaaggtgctgatattacaaaagttgatggctttaaccaatca
atggatttattattgtctaagcgtgttgatggtacatttaatgatagtctgtcatacttg
gattataaaaaacaaaaacctaatgctaagatcaaagcaatcaaaggtaatgctgaacaa
agtagatctgcatttgcattttctaaaaaagcagatgatgaaacagttcaaaaattcaat
gatggcttgaaaaaaatcgaggaaaacggtgaattagctaaaataggtaagaaatggttt
ggtcaagatgtttctaaatctaaatagcgaacaacaacatgcgctagatgctgcaaaaca
agctttcggacctatgctagaaggtttggtcaaatattcaattcctattacattagttac
atttgttttaggattgattattgcattatttacagcattaatgcgaatttcaacgagtaa
aattttaagaagtatttcacgtgtctatgtatctattattcgaggaacaccaatgatagt
acaactatttatcatattttatggtattccagaattaggtagattattaacaaatgacgc
tgacaaccaatggacattggcacctgtagtggctgctattattggtttatcattaaatgt
aggtgcgtatgcttcggaaattattcgtggcggtattatttctataccgaaaggacaaac
agaagctgcatattccatcggtatgacgtatggtcaaacgatacaacgtatcattttacc
gcaggcaattcgagtgtcgattcctgcactaggtaatacatttttaa


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
25 fig|904782.3.peg.2765 amino acid ABC transporter, permease protein
16 fig|904782.3.peg.2766 L-cystine ABC transporter, ATP-binding protein TcyC


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search