The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|904139.4.peg.1334: Salmonella enterica subsp. enterica serovar Choleraesuis str. A50

This feature in The SEED Viewer

NCBI Taxonomy Id: 904139

Current Assignment: KilA protein
Translate Function Assignments



Context on contig AEJH01000003 from base 384180 to 395604 (11425 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1328 384596 384180 417 -           Putative phage tail fibre protein  
1329 386015 384603 1413 - 6         Phage tail fibers  
1330 386695 386015 681 - -1         Putative bacteriophage protein  
1331 387891 386692 1200 - -4         putative bacteriophage protein  
1332 388245 387892 354 - 0         putative bacteriophage protein  
1333 389151 388381 771 - 135         Phage-related protein  
1334 389985 389200 786 - 48         KilA protein  
1335 390697 390050 648 - 64         Phage Rha protein  
1336 390845 390687 159 - -11         FIG01048844: hypothetical protein  
1337 391117 391323 207 + 271         putative regulatory protein  
1338 391470 391330 141 - 6         Putative exported protein  
1339 392693 391662 1032 - 191         putative bacteriophage protein  
1340 392998 392696 303 - 2         Phage protein  
1341 393652 393002 651 - 3         putative bacteriophage protein  
1342 395604 393652 1953 - -1         putative bacteriophage protein  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|904139.4.peg.1334 KilA protein
MDSIIKHFEFKSSEGMAVSIDAARFKGKPVFLAVPLAKALGYTNPADALKKHCKSLIKLN
YSESRELGFGDNPRGIQLVGQADVFRLIMRSSLPSAERVQDWVCEEVLPALMDTGTYSIR
KEKTSSGLPEYRLAKAEQLKALALEKNIASARELMVMLPRLDPMSHQTLAASLINPIIGY
DAIPLPVIEEHYYTAAEAGEKIGVSANKIGRIANANNLKTEQYGKFFLDKSAHSSKQVEA
FRYNAEGVKALRHLIHGADVA

MD5 = 94a0370c55a9c4cdcd277b00a2d16e59


  DNA Sequence

>fig|904139.4.peg.1334 KilA protein
atggattcgattatcaaacatttcgagtttaagtcaagtgaaggtatggctgtaagtatt
gatgcggcccgcttcaaaggaaaaccggtattccttgccgtgccacttgcaaaggctttg
ggttataccaacccggctgatgcattgaaaaaacattgtaagtcactgattaagcttaat
tatagcgaatcgcgagaattgggtttcggtgacaacccgcggggtatccaacttgttggt
caggcagacgtttttcgccttattatgcgcagctccctcccatcagcagaacgtgttcag
gattgggtttgcgaagaagttctccctgcgttaatggataccggaacttacagtatcaga
aaggaaaaaacatcatctggcctccctgaataccgtcttgcaaaggccgaacagttgaag
gcgctggcgctggaaaaaaatatcgcatccgctcgtgagttgatggtgatgctgccccgt
cttgaccctatgtcccaccagacgctggcggcttcgctgattaatccgattatcggttat
gacgcgatccccttgccggtgattgaagagcattactacaccgcagcagaagcgggtgag
aaaataggtgtcagcgccaataaaatcggtcgcatcgctaacgcaaacaaccttaaaact
gagcagtacggcaagttcttccttgataaatccgctcactccagtaaacaggtcgaagcg
tttcgctataacgctgagggcgtaaaagccttacgccatcttattcatggtgctgacgta
gcttaa


  DNA with Flanking Sequence

>fig|904139.4.peg.1334 KilA protein
aatttccaacttatttacgcagtatgaagatgagttttcccaagggatgacaatggtcat
cgaatcagtgaccaatgggattaacggttctactcgtcgtatgaaggtgcgtgttttctc
gcttcgtggtgctcacctaatcgcaatgttcgcccgtaccccagttgccaaagaatttcg
tcgctgggtactggacattctggatcgggaagtagattcctcaggtgccgatcgtctacc
gactaaatttcatcagagggtaatgctttaccttgataccaaagggggcgtcatcaatac
gtacccattgaataaagatcaggtagtcatgtcatttgatgcatttgtcagctatttcag
gaaaaagggatggatagtggccccaagggatgaggttgcaaaaggaataatgggggcaat
acaagttttatcgtagcaaaaaagaaaaaccgccagttgctgctggcggccatcattaac
ttacatagaaggcaaactctatggattcgattatcaaacatttcgagtttaagtcaagtg
aaggtatggctgtaagtattgatgcggcccgcttcaaaggaaaaccggtattccttgccg
tgccacttgcaaaggctttgggttataccaacccggctgatgcattgaaaaaacattgta
agtcactgattaagcttaattatagcgaatcgcgagaattgggtttcggtgacaacccgc
ggggtatccaacttgttggtcaggcagacgtttttcgccttattatgcgcagctccctcc
catcagcagaacgtgttcaggattgggtttgcgaagaagttctccctgcgttaatggata
ccggaacttacagtatcagaaaggaaaaaacatcatctggcctccctgaataccgtcttg
caaaggccgaacagttgaaggcgctggcgctggaaaaaaatatcgcatccgctcgtgagt
tgatggtgatgctgccccgtcttgaccctatgtcccaccagacgctggcggcttcgctga
ttaatccgattatcggttatgacgcgatccccttgccggtgattgaagagcattactaca
ccgcagcagaagcgggtgagaaaataggtgtcagcgccaataaaatcggtcgcatcgcta
acgcaaacaaccttaaaactgagcagtacggcaagttcttccttgataaatccgctcact
ccagtaaacaggtcgaagcgtttcgctataacgctgagggcgtaaaagccttacgccatc
ttattcatggtgctgacgtagcttaattgccaacagataattaataccaagcccgccgat
gagcgggtttttttatgtctggagaaaatatgccagtttcactttcctctcaactcggca
gtaaagaacaggctgatacaaggcttgccagctctatcatgtctgcgttgcgagtttcaa
tgcctggcatcgtccagtcatttgatcccgacaccgtaaccgcagttgttcaacccgcta
tcaaaggctatgagccggattcgaatggcgttagccagtcgacgacattaccgctgctgg
tggatgtgcccgtggtatttcctcgcggcggtggctgcacgctaacgttcccggttaaag
ctggtgatgagtgtctggtgatttttgccgatcgctgcatcgatttctggtggcagaacg
gcggggtacaggagcctgtcgacgatcgggtgcatgatttatcggatgcggtctgtatcg
tcgggccgcagtcgcaggcgcagaaaataagcggaatcagcaccag


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search