The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|904139.4.peg.1333: Salmonella enterica subsp. enterica serovar Choleraesuis str. A50

This feature in The SEED Viewer

NCBI Taxonomy Id: 904139

Current Assignment: Phage-related protein
Translate Function Assignments



Context on contig AEJH01000003 from base 383613 to 395604 (11992 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1327 383613 383765 153 +           FIG01049441: hypothetical protein  
1328 384596 384180 417 - 414         Putative phage tail fibre protein  
1329 386015 384603 1413 - 6         Phage tail fibers  
1330 386695 386015 681 - -1         Putative bacteriophage protein  
1331 387891 386692 1200 - -4 6     putative bacteriophage protein  
1332 388245 387892 354 - 0 4     putative bacteriophage protein  
1333 389151 388381 771 - 135       Phage-related protein  
1334 389985 389200 786 - 48         KilA protein  
1335 390697 390050 648 - 64         Phage Rha protein  
1336 390845 390687 159 - -11         FIG01048844: hypothetical protein  
1337 391117 391323 207 + 271         putative regulatory protein  
1338 391470 391330 141 - 6         Putative exported protein  
1339 392693 391662 1032 - 191 6     putative bacteriophage protein  
1340 392998 392696 303 - 2 6     Phage protein  
1341 393652 393002 651 - 3 4     putative bacteriophage protein  
1342 395604 393652 1953 - -1 5     putative bacteriophage protein  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|904139.4.peg.1333 Phage-related protein
MSGENMPVSLSSQLGSKEQADTRLASSIMSALRVSMPGIVQSFDPDTVTAVVQPAIKGYE
PDSNGVSQSTTLPLLVDVPVVFPRGGGCTLTFPVKAGDECLVIFADRCIDFWWQNGGVQE
PVDDRVHDLSDAVCIVGPQSQAQKISGISTSAAQLRTDDGAAFVEVAAGHNVTVKTPGAL
TATAEGGTTITSPIITLNGDVTINGNLSQGMGEGGGSATMLGPVTVTNDVKAGGKSLMTH
THGGVQTGGGNTGAPN

MD5 = 635cb5f8b8a39b75fbae1228539c0aa9


  DNA Sequence

>fig|904139.4.peg.1333 Phage-related protein
atgtctggagaaaatatgccagtttcactttcctctcaactcggcagtaaagaacaggct
gatacaaggcttgccagctctatcatgtctgcgttgcgagtttcaatgcctggcatcgtc
cagtcatttgatcccgacaccgtaaccgcagttgttcaacccgctatcaaaggctatgag
ccggattcgaatggcgttagccagtcgacgacattaccgctgctggtggatgtgcccgtg
gtatttcctcgcggcggtggctgcacgctaacgttcccggttaaagctggtgatgagtgt
ctggtgatttttgccgatcgctgcatcgatttctggtggcagaacggcggggtacaggag
cctgtcgacgatcgggtgcatgatttatcggatgcggtctgtatcgtcgggccgcagtcg
caggcgcagaaaataagcggaatcagcaccagcgccgcacaattgcgtaccgatgatggg
gctgcttttgtggaagtggccgcaggccataacgttactgttaaaacccccggcgcgctg
actgctactgcagaaggcggaaccacgatcacatcacccatcattacgctaaacggtgac
gtaaccattaacggcaatctgtcgcaggggatgggtgagggcggaggtagcgcaacgatg
ctcggtcctgtcacggtgactaatgatgtgaaggcgggcggtaagagccttatgacgcac
actcatggcggcgtgcagacaggtggcgggaataccggcgcgcctaattaa


  DNA with Flanking Sequence

>fig|904139.4.peg.1333 Phage-related protein
tggataccggaacttacagtatcagaaaggaaaaaacatcatctggcctccctgaatacc
gtcttgcaaaggccgaacagttgaaggcgctggcgctggaaaaaaatatcgcatccgctc
gtgagttgatggtgatgctgccccgtcttgaccctatgtcccaccagacgctggcggctt
cgctgattaatccgattatcggttatgacgcgatccccttgccggtgattgaagagcatt
actacaccgcagcagaagcgggtgagaaaataggtgtcagcgccaataaaatcggtcgca
tcgctaacgcaaacaaccttaaaactgagcagtacggcaagttcttccttgataaatccg
ctcactccagtaaacaggtcgaagcgtttcgctataacgctgagggcgtaaaagccttac
gccatcttattcatggtgctgacgtagcttaattgccaacagataattaataccaagccc
gccgatgagcgggtttttttatgtctggagaaaatatgccagtttcactttcctctcaac
tcggcagtaaagaacaggctgatacaaggcttgccagctctatcatgtctgcgttgcgag
tttcaatgcctggcatcgtccagtcatttgatcccgacaccgtaaccgcagttgttcaac
ccgctatcaaaggctatgagccggattcgaatggcgttagccagtcgacgacattaccgc
tgctggtggatgtgcccgtggtatttcctcgcggcggtggctgcacgctaacgttcccgg
ttaaagctggtgatgagtgtctggtgatttttgccgatcgctgcatcgatttctggtggc
agaacggcggggtacaggagcctgtcgacgatcgggtgcatgatttatcggatgcggtct
gtatcgtcgggccgcagtcgcaggcgcagaaaataagcggaatcagcaccagcgccgcac
aattgcgtaccgatgatggggctgcttttgtggaagtggccgcaggccataacgttactg
ttaaaacccccggcgcgctgactgctactgcagaaggcggaaccacgatcacatcaccca
tcattacgctaaacggtgacgtaaccattaacggcaatctgtcgcaggggatgggtgagg
gcggaggtagcgcaacgatgctcggtcctgtcacggtgactaatgatgtgaaggcgggcg
gtaagagccttatgacgcacactcatggcggcgtgcagacaggtggcgggaataccggcg
cgcctaattaactgataatggagttgcgagttatgggcgaaaaattacccaactggaaat
tcctgcttatatggattgtatttttccttttcgggctttcgagcctgattggtgccgtcc
gatggtggtgaataaggaggtcagacatgcgataccgacgcgaagataccgaaggtgatt
acacttttggtagtggcgatgatacctggctgattaactcgccagaagctgtcgcgcagg
cggtaaaaacacgattcgcattgtggtacgggcagtggctcctcgataagacagagggaa
caccgtggattcagtctgtgctcggtaagcaaaagccggaaacctacaatctggcgatcc
gcaagcgcatcctcgaaacgcggggcgtgaaatccatcctctctttcaataccacagtga
acacgacgacgcgccgcgtccagttcttcgctgaaatcgacactatctacggaacaacga
cagtaaccagcgaggcataaatggccctcaa


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
6 fig|904139.4.peg.1331 putative bacteriophage protein
4 fig|904139.4.peg.1332 putative bacteriophage protein
6 fig|904139.4.peg.1339 putative bacteriophage protein
6 fig|904139.4.peg.1340 Phage protein
4 fig|904139.4.peg.1341 putative bacteriophage protein
5 fig|904139.4.peg.1342 putative bacteriophage protein


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search