The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|875328.3.peg.3368: Mycobacterium sp. JDM601

This feature in The SEED Viewer

NCBI Taxonomy Id: 875328

Current Assignment: Mycofactocin system heme/flavin dehydrogenase
Translate Function Assignments



Context on contig NC_015576 from base 3550319 to 3562557 (12239 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
3364 3550319 3551590 1272 +       1: 3   putative cytochrome P450 hydroxylase gene_name|cyp108B4, locus|JDM601_3344, protein_id|YP_004524597.1, gi|333991983, geneID|10685376
3365 3553017 3551572 1446 - -19         Choline dehydrogenase (EC 1.1.99.1) locus|JDM601_3343, protein_id|YP_004524598.1, gi|333991984, geneID|10685378
3366 3554439 3553024 1416 - 6 4 1: 1   Mycofactocin system glycosyltransferase locus|JDM601_3345, protein_id|YP_004524599.1, gi|333991985, geneID|10685377
3367 3555293 3554436 858 - -4     1: 2   Creatinine amidohydrolase (EC 3.5.2.10) locus|JDM601_3346, protein_id|YP_004524600.1, gi|333991986, geneID|10685379
3368 3556555 3555362 1194 - 68   1: 1   Mycofactocin system heme/flavin dehydrogenase gene_name|lldD1, locus|JDM601_3347, protein_id|YP_004524601.1, gi|333991987, geneID|10685380
3369 3557746 3556559 1188 - 3     1: 1   Mycofactocin radical SAM maturase gene_name|pqqE, locus|JDM601_3348, protein_id|YP_004524602.1, gi|333991988, geneID|10685381
3370 3558078 3557743 336 - -4     1: 1   Mycofactocin system small protein locus|JDM601_3349, protein_id|YP_004524603.1, gi|333991989, geneID|10685382
3371 3558218 3558063 156 - -16     1: 1   Mycofactocin precursor locus|JDM601_3350, protein_id|YP_004524604.1, gi|333991990, geneID|10685383
3372 3558274 3558873 600 + 55     1: 1   Mycofactocin system transcriptional regulator locus|JDM601_3351, protein_id|YP_004524605.1, gi|333991991, geneID|10685384
3373 3560043 3558964 1080 - 90         N5,N10-methylenetetrahydromethanopterin reductase-related protein locus|JDM601_3352, protein_id|YP_004524606.1, gi|333991992, geneID|10685385
3374 3560390 3560007 384 - -37         FIG00822683: hypothetical protein locus|JDM601_3353, protein_id|YP_004524607.1, gi|333991993, geneID|10685386
3375 3561457 3560387 1071 - -4         FIG00832253: hypothetical protein locus|JDM601_3354, protein_id|YP_004524608.1, gi|333991994, geneID|10685387
3376 3562557 3561454 1104 - -4         FIG00823551: hypothetical protein locus|JDM601_3355, protein_id|YP_004524609.1, gi|333991995, geneID|10685388

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
mycofactocin_system Mycofactocin system heme/flavin dehydrogenase


  Protein Sequence

>fig|875328.3.peg.3368 Mycofactocin system heme/flavin dehydrogenase
MARDIWFETVAIAQERARKRLPKSAYSSLISASEKGVTVSDNVEAFSELGFAPHVVGACE
KRDLSTTVMGQELSFPVMISPTGVQAVDPDGEVAVARAAAARGTAMGLSSFASKPMEEVI
AANPKTFFQIYWLGGRDAIAERVERARAAGAVGLIATTDWSFSHGRDWGSPKIPEQMDLK
TMIKMMPEALGRPRWFLQWAKTLRPPSLRVPNQGRRGEPGPPFFQAYGEWMGTPPPTWED
IAWLRELWGGPFMLKGVMRVDDAKKAVDAGVSAISVSNHGGNNLDGTPAAIRALPAVAEA
VGGQIDVLLDGGIRRGSDVVKAVALGARAVMIGRAYLWGLAAAGQPGVENVLDILRGGID
SALMGLGRASVHDLSPDDILIPPGFARALGVPSDGGR

MD5 = 48e472ed19794fd5acf4168d1a5c6427


  DNA Sequence

>fig|875328.3.peg.3368 Mycofactocin system heme/flavin dehydrogenase
atggctcgtgatatctggttcgaaaccgtcgccatcgcccaggagcgagcgcgcaaacgc
ctcccgaagtccgcgtactcgtcgctgatctcagccagcgagaagggcgtgaccgtctcc
gacaacgtcgaggcgttcagcgagctgggtttcgctccgcacgtggtcggcgcgtgcgag
aaacgtgatctgtcgactaccgttatgggccaggagctttcgtttccggtaatgatctcg
ccgacgggcgtgcaggcggtcgacccggacggcgaggtcgccgtcgcgcgggccgccgcc
gcgcgcggcaccgctatgggcctgtcgtcgttcgccagcaagccgatggaagaggtcatc
gccgccaaccccaagaccttcttccagatctactggctcgggggccgcgatgcgatcgcc
gaacgcgtcgagcgcgcccgggccgccggtgcggtgggcctgattgccaccaccgattgg
tccttctcgcacggccgggactggggaagccccaaaatcccggagcagatggatctcaag
accatgatcaagatgatgcccgaggccctgggccggccgcggtggtttttgcagtgggcc
aagaccctgcgcccgccgagcttgcgggtgcccaaccagggccgacgcggcgaaccgggt
ccgccgttcttccaggcctacggcgagtggatgggaacaccgccgccgacctgggaggac
atcgcgtggctgcgcgaactctggggcgggcccttcatgctcaagggtgtcatgcgggtc
gacgatgcgaaaaaggctgtagacgctggagtttcggcgatctccgtgtcgaaccacggt
ggtaacaacctggacggcacaccggcggcgatccgggcgctgcccgctgtcgccgaggcg
gtcggcggccagatcgatgttttgctggatggtggcatccgacggggcagcgacgtcgtc
aaggcggtggcgctgggcgcccgggcggtgatgatcggccgcgcctacctgtgggggctg
gccgcggccggccagcccggggtggagaacgtcctcgacatcctgcgcggcgggatcgac
tcggccctgatggggctcgggcgggcctccgtgcacgatctgtcgccggacgacatcctg
atcccgcccggtttcgcccgcgcgctcggtgtgccctccgacggaggccggtag


  DNA with Flanking Sequence

>fig|875328.3.peg.3368 Mycofactocin system heme/flavin dehydrogenase
ccggggactccttcttccacctggcgccgctcggcgagtccggtgcgctggctggcctga
acatgtgcggagccggacgggtggtctgcctgatcgacccggtcggtgacgtttacgcct
gcccgttcgccatccacgaccagttcttggccggaaatgtgttgaccgacggcgggttcg
atcaggtgtggaagcactccaagctgttcaacgagctgcgcagccccacggcgggcggcg
cctgtgccagctgcccgctgtatgacacctgccggggcggctgcatggccgccaagttct
tcaccggcctgccgatggacggacccgacccggaatgcgttcgtgggttcggcgagcagg
cgctggccggcgaccgacagaagccgcgtccgagcagcgaccactcgcgtggaaagcgca
gcagcacaagacaatcccttaccctgctcaatccggcgaagccgcccaagcggctgtgcg
atgaaagtccggtctgatcgatggctcgtgatatctggttcgaaaccgtcgccatcgccc
aggagcgagcgcgcaaacgcctcccgaagtccgcgtactcgtcgctgatctcagccagcg
agaagggcgtgaccgtctccgacaacgtcgaggcgttcagcgagctgggtttcgctccgc
acgtggtcggcgcgtgcgagaaacgtgatctgtcgactaccgttatgggccaggagcttt
cgtttccggtaatgatctcgccgacgggcgtgcaggcggtcgacccggacggcgaggtcg
ccgtcgcgcgggccgccgccgcgcgcggcaccgctatgggcctgtcgtcgttcgccagca
agccgatggaagaggtcatcgccgccaaccccaagaccttcttccagatctactggctcg
ggggccgcgatgcgatcgccgaacgcgtcgagcgcgcccgggccgccggtgcggtgggcc
tgattgccaccaccgattggtccttctcgcacggccgggactggggaagccccaaaatcc
cggagcagatggatctcaagaccatgatcaagatgatgcccgaggccctgggccggccgc
ggtggtttttgcagtgggccaagaccctgcgcccgccgagcttgcgggtgcccaaccagg
gccgacgcggcgaaccgggtccgccgttcttccaggcctacggcgagtggatgggaacac
cgccgccgacctgggaggacatcgcgtggctgcgcgaactctggggcgggcccttcatgc
tcaagggtgtcatgcgggtcgacgatgcgaaaaaggctgtagacgctggagtttcggcga
tctccgtgtcgaaccacggtggtaacaacctggacggcacaccggcggcgatccgggcgc
tgcccgctgtcgccgaggcggtcggcggccagatcgatgttttgctggatggtggcatcc
gacggggcagcgacgtcgtcaaggcggtggcgctgggcgcccgggcggtgatgatcggcc
gcgcctacctgtgggggctggccgcggccggccagcccggggtggagaacgtcctcgaca
tcctgcgcggcgggatcgactcggccctgatggggctcgggcgggcctccgtgcacgatc
tgtcgccggacgacatcctgatcccgcccggtttcgcccgcgcgctcggtgtgccctccg
acggaggccggtagcccgctcaggccgtccacctgcgaactcccggcctatccctggtac
tgccgtggcggacgggacgggcgtgatgttcggcgatcgctccggagtgccgatggccag
gaatttctttgccttccctgtcaataactggtgtacggcaggtgaattcgcttaccatcg
tccgatggcggttcgtggcgacctcggtagttcgacctggggcgagctgcagaaccggct
acagcgccagctgccggggcagtcgctgaccctgctggtcccggtcgggtcgaccgaaca
gcacggacggcacctgccgctggacaccgacacccggatcgcgcaggcgctcgcgcgggc
ggtggccgggcggctgcgcagaaccgcgtcggggcgcgatgagcacgcctggtcggtggc
gcccgcggtggcctacggcgccagtggggagcaccagagcttcgccggaaccatctcgat
cggcaccgaggtgctgagtcgagtgttgctggag


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
4 fig|875328.3.peg.3366 Mycofactocin system glycosyltransferase


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search