The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|869684.5.peg.5494: Escherichia coli 5.0959

This feature in The SEED Viewer

NCBI Taxonomy Id: 869684

Current Assignment: FIG00643952: hypothetical protein
Translate Function Assignments



Context on contig AEZX02000028 from base 436 to 7766 (7331 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
5491 436 744 309 +           Integrase locus|EC50959_3532, protein_id|EII07889.1, gi|386203364
5492 1222 1803 582 + 477         COG3617: Prophage antirepressor locus|EC50959_3534, protein_id|EII07903.1, gi|386203378
5493 2103 1924 180 - 120         conserved hypothetical protein locus|EC50959_3535, protein_id|EII07888.1, gi|386203363
5494 2336 2503 168 + 232         FIG00643952: hypothetical protein locus|EC50959_3536, protein_id|EII07898.1, gi|386203373
5495 2496 2720 225 + -8         FIG00638379: hypothetical protein locus|EC50959_3537, protein_id|EII07890.1, gi|386203365
5496 2713 3081 369 + -8         FIG00641729: hypothetical protein locus|EC50959_3538, protein_id|EII07896.1, gi|386203371
5497 3074 3307 234 + -8         FIG00641184: hypothetical protein locus|EC50959_3539, protein_id|EII07895.1, gi|386203370
5498 3300 3473 174 + -8         FIG00640024: hypothetical protein locus|EC50959_3540, protein_id|EII07894.1, gi|386203369
5499 3600 3746 147 + 126         FIG00638501: hypothetical protein locus|EC50959_3541, protein_id|EII07902.1, gi|386203377
5500 3743 5557 1815 + -4         DNA primase (EC 2.7.7.-), phage-associated locus|EC50959_3542, protein_id|EII07897.1, gi|386203372
5501 5911 6090 180 + 353         hypothetical protein locus|EC50959_3543, protein_id|EII07891.1, gi|386203366
5502 6087 6509 423 + -4         Putative single stranded DNA-binding protein of prophage gene_name|ssb, locus|EC50959_3544, protein_id|EII07900.1, gi|386203375
5503 7039 7170 132 + 529         hypothetical protein  
5504 7167 7766 600 + -4         Prophage Clp protease-like protein gene_name|clpP, locus|EC50959_3546, protein_id|EII07892.1, gi|386203367

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|869684.5.peg.5494 FIG00643952: hypothetical protein
MHNLNKFTWRFIALSTAQPRVITIEATSEQEARQQSPVGCVMVFAARIRQGVEHV

MD5 = bc73ab5a498aad2c20dba65e2d266815


  DNA Sequence

>fig|869684.5.peg.5494 FIG00643952: hypothetical protein
ttgcacaacctgaataaattcacctggcgttttatcgccctgagcacggcacaaccgcgc
gtgattaccattgaggccaccagcgaacaggaagcacgccagcaatccccagttggctgc
gtgatggtattcgccgcccgtattcgtcagggggtggaacatgtgtaa


  DNA with Flanking Sequence

>fig|869684.5.peg.5494 FIG00643952: hypothetical protein
aatgggaaaacactaaacataagcccaaacatcatagcgatttgttggctggtgggcaat
gtgatcagtgtgctggcttgctggtggactattccgcttctttggccttgcggcgctggc
ggcgtttgatctcgcctcgcatggctgtaacgataaattgcgcagtgctctcgcctgttt
cttttacttgctccatagcctcaacaacttcatgcggggcgcgagcctgtaatttctgtg
atttgttattgatatggtctctttccatttctggttccctttgtgattactggaatccag
tatacacgaaaaagaccaaaacaaaacgcttgaagtggattccacttagtgattatactg
gaatccagttgagtgtttatcactcaatgcaaacgaggctgaaaaggattgccgtccttt
cgcagcctctgaccaccaacgatagcaacagtatcgaggtagctatgagaaatcatacca
cacacccgcaagggcgggacttgcacaacctgaataaattcacctggcgttttatcgccc
tgagcacggcacaaccgcgcgtgattaccattgaggccaccagcgaacaggaagcacgcc
agcaatccccagttggctgcgtgatggtattcgccgcccgtattcgtcagggggtggaac
atgtgtaatgcaacatggcctgatgcagcggtagacgctatcaaaacgctgatggattca
cttattgagatttctgctatcgctggtgtggcgcataaacacgcagccagagaatcagaa
tgcatcttccattatttagcatttgtgcagctaaaagccgatcaggcactggataaggcc
ggaaaaattatcatggctgatgtgcaggaggtgcaccatgcataacctgtcaatttctga
ccttaacagcattcagtttgacgagatattttccgggcagctactggtcaacgtggagaa
tggacgcgtggtaagtaattatcacctgccggatggtgcaattgccggaagcgttgaagc
attgctggaactggcggaacgtgcgcgactgattaagccgtcaacgtgccatcacgatga
tgatctgcattttaccggacgcatggtgagtcactacgaaaacggcgttgaagtatcccg
cgaacgtctgcgtgatgattgctgtttc


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search