The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|754026.3.peg.1895: Staphylococcus aureus subsp. aureus MRSA177

This feature in The SEED Viewer

NCBI Taxonomy Id: 754026

Current Assignment: L-cystine ABC transporter, ATP-binding protein TcyC
Translate Function Assignments



Context on contig AECP01000046 from base 15660 to 26952 (11293 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1890 15660 16526 867 +       1: 2 dlit(30808698)
dlit(19226325)
Cation diffusion facilitator MntE locus|HMPREF9529_02000, protein_id|EFW34309.1, gi|320142500, InterPro:IPR002524
1891 16853 17539 687 + 326     1: 3   Phosphoglycerate mutase (EC 5.4.2.11) locus|HMPREF9529_02001, protein_id|EFW34310.1, gi|320142501, InterPro:IPR005952, InterPro:IPR013078
1892 17971 19410 1440 + 431         FIG01107989: hypothetical protein locus|HMPREF9529_02002, protein_id|EFW34311.1, gi|320142502, InterPro:IPR004638, InterPro:IPR011701
1893 19531 20310 780 + 120         L-Cystine ABC transporter, periplasmic cystine-binding protein TcyA locus|HMPREF9529_02003, protein_id|EFW34312.1, gi|320142503, InterPro:IPR001638
1894 20291 21010 720 + -20         amino acid ABC transporter, permease protein locus|HMPREF9529_02004, protein_id|EFW34313.1, gi|320142504, InterPro:IPR000515, InterPro:IPR010065
1895 21007 21738 732 + -4         L-cystine ABC transporter, ATP-binding protein TcyC locus|HMPREF9529_02005, protein_id|EFW34314.1, gi|320142505, InterPro:IPR003439
1896 23085 21835 1251 - 96     1: 1   FmhA protein of FemAB family locus|HMPREF9529_02006, protein_id|EFW34315.1, gi|320142506, InterPro:IPR003447
1897 23340 23699 360 + 254         FIG01108076: hypothetical protein locus|HMPREF9529_02007, protein_id|EFW34316.1, gi|320142507
1898 23718 24317 600 + 18         Protein-disulfide isomerase, related to DsbA locus|HMPREF9529_02008, protein_id|EFW34317.1, gi|320142508
1899 24590 24841 252 + 272         Antitoxin DinJ (binds YafQ toxin) locus|HMPREF9529_02009, protein_id|EFW34318.1, gi|320142509, InterPro:IPR003756, InterPro:IPR006442
1900 24916 25107 192 + 74         FIG01108752: hypothetical protein locus|HMPREF9529_02010, protein_id|EFW34319.1, gi|320142510, InterPro:IPR009614
1901 25402 26952 1551 + 294         Zinc ABC transporter, substrate-binding AdcA / Metal-binding protein ZinT locus|HMPREF9529_02011, protein_id|EFW34320.1, gi|320142511, InterPro:IPR006127, InterPro:IPR015304

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|754026.3.peg.1895 L-cystine ABC transporter, ATP-binding protein TcyC
MIQLNNIHKSFNDVEVIKGIDLSVEQGEVVTLIGRSGSGKTTLLRMINALEIPTEGTVYV
NGKTYTSKDKKSQIEVRKQSGMVFQSYNLFPHKTALENVMEGLITVKKLKKDEARGKSLE
LLEKVGLTHVKDQRPHALSGGQQQRVAIARALAMNPKVMLFDEPTSALDPELVNDVLKVI
KDLANEGMTMVIVTHEMRFAKEVSNNIVFIHEGMIGEQGAPEEMFNRPKTEELRRFLNVI
NEE

MD5 = 3cb3645d47ce1ea9a6a50006c00eda0b


  DNA Sequence

>fig|754026.3.peg.1895 L-cystine ABC transporter, ATP-binding protein TcyC
atgattcaattgaacaatatccataaatcatttaatgatgttgaagtcatcaaaggtatt
gatttatctgttgaacaaggtgaggttgtaaccttaatcggtcgatctggttcaggtaaa
acaacattgttacgtatgattaatgcattagaaattccaactgaaggtacagtttatgtt
aacggcaaaacatatacatctaaagataaaaaatcacaaatagaagttcgtaaacagtct
ggtatggtatttcaaagttataacctttttccgcataagacggcattagaaaatgtaatg
gaaggtcttatcacagttaaaaagttgaaaaaggatgaggcacgtgggaaatcacttgag
ttacttgagaaagttggtttaacacatgtcaaagatcaacgtccacatgcattatcaggt
ggtcaacaacaacgtgttgctattgcaagagcactagcaatgaaccctaaagtgatgttg
tttgatgaaccaacatctgcacttgatcctgaacttgtgaatgatgttttaaaggttatt
aaagatttggctaatgaaggcatgacaatggtcattgtgacacatgaaatgcgttttgct
aaagaagtatctaataacattgtatttattcatgaaggcatgatcggagaacaaggggct
ccagaagagatgttcaatcgtccgaaaacagaagaattaagacgtttcttaaatgttata
aatgaagaataa


  DNA with Flanking Sequence

>fig|754026.3.peg.1895 L-cystine ABC transporter, ATP-binding protein TcyC
ggaacaccaatgatagtacaactatttatcatattttatggtattccagaattaggtaga
ttattaacaaatgacgctgacaaccaatggacattggcacctgtagtggctgctattatt
ggtttatcattaaatgtaggtgcgtatgcttcggaaattattcgtggcggtattatttct
ataccgaaaggacaaacagaagctgcatattccatcggtatgacgtatggtcaaacgata
caacgtatcattttaccgcaggcaattcgagtgtcgattcctgcactaggtaatacattt
ttaagtttaatcaaagatacatcattattaggatttattttagtggctgaaatgtttaga
aaagctcaagaagttgcgtctacaacatatgaatatttaacaatttatgtgttagttgcg
ctaatgtactgggtggtatgctttattatttcaattatccaaggtatctatgaatcttat
attgaaagagggtatcgctcatgattcaattgaacaatatccataaatcatttaatgatg
ttgaagtcatcaaaggtattgatttatctgttgaacaaggtgaggttgtaaccttaatcg
gtcgatctggttcaggtaaaacaacattgttacgtatgattaatgcattagaaattccaa
ctgaaggtacagtttatgttaacggcaaaacatatacatctaaagataaaaaatcacaaa
tagaagttcgtaaacagtctggtatggtatttcaaagttataacctttttccgcataaga
cggcattagaaaatgtaatggaaggtcttatcacagttaaaaagttgaaaaaggatgagg
cacgtgggaaatcacttgagttacttgagaaagttggtttaacacatgtcaaagatcaac
gtccacatgcattatcaggtggtcaacaacaacgtgttgctattgcaagagcactagcaa
tgaaccctaaagtgatgttgtttgatgaaccaacatctgcacttgatcctgaacttgtga
atgatgttttaaaggttattaaagatttggctaatgaaggcatgacaatggtcattgtga
cacatgaaatgcgttttgctaaagaagtatctaataacattgtatttattcatgaaggca
tgatcggagaacaaggggctccagaagagatgttcaatcgtccgaaaacagaagaattaa
gacgtttcttaaatgttataaatgaagaataatcaaatagaaccacgtatcatgttttag
tatggcgatgaagccatatacatgatgcgtggttctttgttatgttgtcataatcttgga
gcgatattttaacgacgtttatgatttaagtacgtttgtaccttatatagtaatggtttg
ataggcttaataaagtcaccgatatactcttctacatgtgcgttaaaaccttttttgaat
tgttggacgccatagtcttctgatgactctgaaaagtcaccggtaataccataaaaatta
tagcgatcaatatgatgcgctttagcaaacttaatcatttcccactgcaaatggtaggca
cccatataagcattatatttagggtttgaaccactagataagtaataaacttcatgctca
ttgtagataaataaagcagaagctaagtttaagactgcaccatcttgttcaatttgttct
attgtattgtcgattttacgcttattgctatttagctgttgttctagctgtg


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search