The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|754026.3.peg.1893: Staphylococcus aureus subsp. aureus MRSA177

This feature in The SEED Viewer

NCBI Taxonomy Id: 754026

Current Assignment: L-Cystine ABC transporter, periplasmic cystine-binding protein TcyA
Translate Function Assignments



Context on contig AECP01000046 from base 13598 to 25107 (11510 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1889 14908 13598 1311 -           IgG-binding protein SBI locus|HMPREF9529_01999, protein_id|EFW34308.1, gi|320142499, InterPro:IPR003132
1890 15660 16526 867 + 751     1: 1 dlit(30808698)
dlit(19226325)
Cation diffusion facilitator MntE locus|HMPREF9529_02000, protein_id|EFW34309.1, gi|320142500, InterPro:IPR002524
1891 16853 17539 687 + 326     1: 2   Phosphoglycerate mutase (EC 5.4.2.11) locus|HMPREF9529_02001, protein_id|EFW34310.1, gi|320142501, InterPro:IPR005952, InterPro:IPR013078
1892 17971 19410 1440 + 431         FIG01107989: hypothetical protein locus|HMPREF9529_02002, protein_id|EFW34311.1, gi|320142502, InterPro:IPR004638, InterPro:IPR011701
1893 19531 20310 780 + 120       L-Cystine ABC transporter, periplasmic cystine-binding protein TcyA locus|HMPREF9529_02003, protein_id|EFW34312.1, gi|320142503, InterPro:IPR001638
1894 20291 21010 720 + -20 28     amino acid ABC transporter, permease protein locus|HMPREF9529_02004, protein_id|EFW34313.1, gi|320142504, InterPro:IPR000515, InterPro:IPR010065
1895 21007 21738 732 + -4 16     L-cystine ABC transporter, ATP-binding protein TcyC locus|HMPREF9529_02005, protein_id|EFW34314.1, gi|320142505, InterPro:IPR003439
1896 23085 21835 1251 - 96         FmhA protein of FemAB family locus|HMPREF9529_02006, protein_id|EFW34315.1, gi|320142506, InterPro:IPR003447
1897 23340 23699 360 + 254         FIG01108076: hypothetical protein locus|HMPREF9529_02007, protein_id|EFW34316.1, gi|320142507
1898 23718 24317 600 + 18         Protein-disulfide isomerase, related to DsbA locus|HMPREF9529_02008, protein_id|EFW34317.1, gi|320142508
1899 24590 24841 252 + 272         Antitoxin DinJ (binds YafQ toxin) locus|HMPREF9529_02009, protein_id|EFW34318.1, gi|320142509, InterPro:IPR003756, InterPro:IPR006442
1900 24916 25107 192 + 74         FIG01108752: hypothetical protein locus|HMPREF9529_02010, protein_id|EFW34319.1, gi|320142510, InterPro:IPR009614

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|754026.3.peg.1893 L-Cystine ABC transporter, periplasmic cystine-binding protein TcyA
MKRLLFVMIAFVFILAACGNNSSKDKEASKDSKTINVGTEGTYAPFSFHDKDGKLTGYDI
DVIKAVAKEEGLKLKFNETSWDSMFAGLDAGRFDVIANQVGINPDREKKYKFSKPYTFSS
AVLVIRENEKDIKDFDDVKGKKLAQTFTSNYGKLAKDKGADITKVDGFNQSMDLLLSKRV
DGTFNDSLSYLDYKKQKPNAKIKAIKGNAEQSRSAFAFSKKADDETVQKFNDGLKKIEEN
GELAKIGKKWFGQDVSKSK

MD5 = 666837dbe7c757f98a97dcf55c333bb5


  DNA Sequence

>fig|754026.3.peg.1893 L-Cystine ABC transporter, periplasmic cystine-binding protein TcyA
atgaaaagacttttatttgtgatgatagctttcgttttcatattggctgcatgcggaaac
aattcgtcgaaagacaaggaagctagtaaagatagcaagacaattaatgttgggactgag
gggacttatgcaccatttagtttccacgataaagatggtaaattaactggttacgatatt
gatgttattaaagcagtggctaaagaagaaggtttaaaacttaaatttaatgaaacttct
tgggattctatgtttgcaggtttagacgcagggcgttttgatgtaatcgcgaaccaagta
ggtattaatcctgatagagaaaagaaatataaattttctaagccttacacattctcaagt
gctgttttagttattcgtgaaaatgaaaaagatattaaagattttgatgatgttaaaggt
aagaagttagcacaaacattcacatctaattatggtaaattagctaaggataaaggtgct
gatattacaaaagttgatggctttaaccaatcaatggatttattattgtctaagcgtgtt
gatggtacatttaatgatagtctgtcatacttggattataaaaaacaaaaacctaatgct
aagatcaaagcaatcaaaggtaatgctgaacaaagtagatctgcatttgcattttctaaa
aaagcagatgatgaaacagttcaaaaattcaatgatggcttgaaaaaaatcgaggaaaac
ggtgaattagctaaaataggtaagaaatggtttggtcaagatgtttctaaatctaaatag


  DNA with Flanking Sequence

>fig|754026.3.peg.1893 L-Cystine ABC transporter, periplasmic cystine-binding protein TcyA
tgttggcaacagtttatgcgattcgaatggttggtatcgcgttaggattaattccagtaa
tgacccatacgatgaatcaattaaagccagaaatgaatgcacatggttcatctatgacaa
acacagtacaacaaattgctggttctatcggaacagctgcattaattactattttatccc
atgcaagcaaaaacttttctccaactatgtcagactataatggcatgaacaaaattgata
tgatgaatcaaattaaagttgatacgatgttgcatggttatcacgctggatttttatttg
cattattgattacagttgttagtttcttttgttcatttatgttacaaggtaagaaaaaag
aagttgattctcgtcaataaatataagttgctagctatataaagctttttagcaaaagtt
caacatattgacttatccggcatttcagattaaaatatttttattccgattagaataata
agaataaggagatatattctatgaaaagacttttatttgtgatgatagctttcgttttca
tattggctgcatgcggaaacaattcgtcgaaagacaaggaagctagtaaagatagcaaga
caattaatgttgggactgaggggacttatgcaccatttagtttccacgataaagatggta
aattaactggttacgatattgatgttattaaagcagtggctaaagaagaaggtttaaaac
ttaaatttaatgaaacttcttgggattctatgtttgcaggtttagacgcagggcgttttg
atgtaatcgcgaaccaagtaggtattaatcctgatagagaaaagaaatataaattttcta
agccttacacattctcaagtgctgttttagttattcgtgaaaatgaaaaagatattaaag
attttgatgatgttaaaggtaagaagttagcacaaacattcacatctaattatggtaaat
tagctaaggataaaggtgctgatattacaaaagttgatggctttaaccaatcaatggatt
tattattgtctaagcgtgttgatggtacatttaatgatagtctgtcatacttggattata
aaaaacaaaaacctaatgctaagatcaaagcaatcaaaggtaatgctgaacaaagtagat
ctgcatttgcattttctaaaaaagcagatgatgaaacagttcaaaaattcaatgatggct
tgaaaaaaatcgaggaaaacggtgaattagctaaaataggtaagaaatggtttggtcaag
atgtttctaaatctaaatagcgaacaacaacatgcgctagatgctgcaaaacaagctttc
ggacctatgctagaaggtttggtcaaatattcaattcctattacattagttacatttgtt
ttaggattgattattgcattatttacagcattaatgcgaatttcaacgagtaaaatttta
agaagtatttcacgtgtctatgtatctattattcgaggaacaccaatgatagtacaacta
tttatcatattttatggtattccagaattaggtagattattaacaaatgacgctgacaac
caatggacattggcacctgtagtggctgctattattggtttatcattaaatgtaggtgcg
tatgcttcggaaattattcgtggcggtattatttctataccgaaaggacaaacagaagct
gcatattccatcggtatgacgtatggtcaaacgatacaacgtatcattttaccgcaggca
attcgagtgtcgattcctgcactaggtaatacatttttaa


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
28 fig|754026.3.peg.1894 amino acid ABC transporter, permease protein
16 fig|754026.3.peg.1895 L-cystine ABC transporter, ATP-binding protein TcyC


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search