The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|682148.3.peg.1123: Gardnerella vaginalis 5-1

This feature in The SEED Viewer

NCBI Taxonomy Id: 682148

Current Assignment: hypothetical protein
Translate Function Assignments



Context on contig NZ_ADAN01000092 from base 1180 to 11314 (10135 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1119 1180 2346 1167 +           Phage protein locus|GV51_1081, protein_id|ZP_06977382.1, gi|298253793
1120 2351 2899 549 + 4         Phage protein locus|GV51_1082, protein_id|ZP_06977383.1, gi|298253794
1121 3126 5102 1977 + 226         FIG006036: phage encoded DNA polymerase I (EC 2.7.7.7) locus|GV51_1084, protein_id|ZP_06977385.1, gi|298253796
1122 5200 5991 792 + 97         Phage antirepressor protein locus|GV51_1085, protein_id|ZP_06977386.1, gi|298253797
1123 6242 6358 117 + 250         hypothetical protein locus|GV51_1086, protein_id|ZP_06977387.1, gi|298253798
1124 6351 8678 2328 + -8         DNA primase, phage associated locus|GV51_1087, protein_id|ZP_06977388.1, gi|298253799
1125 9095 9244 150 + 416         FIG00672347: hypothetical protein locus|GV51_1088, protein_id|ZP_06977389.1, gi|298253800
1126 9487 10926 1440 + 242         DNA helicase, phage-associated locus|GV51_1090, protein_id|ZP_06977391.1, gi|298253802
1127 11105 11314 210 + 178         FIG00672546: hypothetical protein locus|GV51_1091, protein_id|ZP_06977392.1, gi|298253803

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|682148.3.peg.1123 hypothetical protein
MFGEKITGGMQVEINLAEKRRQPIKYFTDKDLGVNVDA

MD5 = b9af39166aa55d2ac0d80e72c2d50d4e


  DNA Sequence

>fig|682148.3.peg.1123 hypothetical protein
gtgttcggagaaaaaatcacaggcggcatgcaagtagaaatcaatttggctgaaaaacgc
aggcagccgattaagtattttacggataaggatttgggggtgaatgttgatgcgtag


  DNA with Flanking Sequence

>fig|682148.3.peg.1123 hypothetical protein
acagtggatgaataactttttgcatgagctcggtgtgcagtataggcagtctgatatctg
gcttttatatcaaaagtatgccaatcaggaatatacgaaatctcgcacaaatacatacga
ggattctaatggtgttacacactcaaaaatgcatacttattggactcagaaaggcaggct
tttcatctatcacctcatgacacaacacggtatctacccgttgattgaacaggaggctaa
agatgagtaagtcttataaaaagcatttagaaacaacaccgaattttaagcctatcgtct
acatttgtgctccctaccgtggagataaggaaagaaacgttaagcacgctattcggtgtg
cggcttacgcgtattcacgcggagcaatccctatcactccacacctgcttttccctttca
tggatgatgagaatcaaaagcatagaggggatgcgatgtttatggacattatcctcttag
gcaagtgcaacgaactatgggtgttcggagaaaaaatcacaggcggcatgcaagtagaaa
tcaatttggctgaaaaacgcaggcagccgattaagtattttacggataaggatttggggg
tgaatgttgatgcgtagtttagctatcgcttacggtaacaacaggcaggcaaagacatgg
gtgaataagaccatcacctatggtgagctgaaagaccgtcttaaagtgacgattcgcacc
tcagagtcagcggaagagtatgcaaaaatgaagaaaacggatcgtgatcttgcaaaagac
cacggtggtttcgttgcaggagcgttggcttacggtagacgaaaagtcgacagcgttgaa
tttcgctccatgctcgccttagatggggatcatgttgctaaagactttattgtactctac
gagagtgttgcgccttacacgtcttttctgtacacgacacacagccacacgcctgataat
ccgagggtgagaattgtttttcctttaacaaggaatgtaacacctgacgagtttgtagca
gtgtcaaggtatttagctgacatgctgggtattgaccagtttgatgaatgctcttacttg
cctaaccagctcatgtactggccgtccacgccacaaa


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search